Property Summary

NCBI Gene PubMed Count 13
PubMed Score 28.91
PubTator Score 5.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 7.7e-04
Waldenstrons macroglobulinemia 765 6.9e-03
Disease Target Count Z-score Confidence
Vascular disease 319 0.0 1.2

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer -1.100 7.7e-04
Waldenstrons macroglobulinemia 1.081 6.9e-03

 GWAS Trait (1)

Gene RIF (1)

AA Sequence

MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDAYL      1 - 70
DAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVD     71 - 140
ELYREAPIDKKGNFNYIEFTRILKHGAKDKDD                                          141 - 172
//

Text Mined References (22)

PMID Year Title