1. Home
  2. Targets
  3. ligase
  4. ubiquitin-protein ligase
  5. Cytochrome b-c1 complex subunit 8

Tbio Cytochrome b-c1 complex subunit 8

This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit, together with cytochrome b, binds to ubiquinone.

This gene encodes a ubiquinone-binding protein of low molecular mass. This protein is a small core-associated protein and a subunit of ubiquinol-cytochrome c reductase complex III, which is part of the mitochondrial respiratory chain. [provided by RefSeq, Jul 2008]

 Comments

Property Summary

NCBI Gene PubMed Count 10
PubMed Score 10.57
PubTator Score 6.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
ovarian cancer 8492 4.52114070527527E-5
lung cancer 4473 1.1809336626177E-4
Multiple myeloma 1328 8.088728477511E-4

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.302 0.001
lung cancer 1.400 0.000
ovarian cancer 1.900 0.000

Synonym

Accession O14949 Q5FVE2 Q9BV88 Q9T2V7
Symbols QPC
QCR8
QP-C
UQCR7
MC3DN4

Gene

UQCRQ

PANTHER Protein Class (2)

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid

 GO Function (1)

 GO Component (3)

 GO Process (9)

 Compartment GO Term (43)

See all...

 HCA RNA Cell Line (56)

See all...

Pathway (14)

See all...

 UniProt Keyword (13)

See all...

Gene RIF (4)

PMID Text
25950827 QP-C protein gene expression involved in the development of hyperpigmentation.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20440543 Decreased electron Transport Complex III activity is associated with ulcerative colitis.
18439546 We thus suggest that a homozygous mutation in UQCRQ is associated with defective function of mitochondrial complex III, leading to a severe autosomal-recessive neurological phenotype.

AA Sequence 

MGREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERS      1 - 70
KRKNPAAYENDK                                                               71 - 82
//

Text Mined References (12)

PMID Year Title
25950827 2015 Identification of Genes Expressed in Hyperpigmented Skin Using Meta-Analysis of Microarray Data Sets.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20440543 2010 Mitochondrial respiratory chain in the colonic mucosal of patients with ulcerative colitis.
18439546 2008 Mitochondrial complex III deficiency associated with a homozygous mutation in UQCRQ.
15544925 2004 Oxidative modification of mitochondrial respiratory complexes in response to the stress of Trypanosoma cruzi infection.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...