Property Summary

NCBI Gene PubMed Count 10
PubMed Score 10.57
PubTator Score 6.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.302 0.001
lung cancer 1.400 0.000
ovarian cancer 1.900 0.000

Synonym

Accession O14949 Q5FVE2 Q9BV88 Q9T2V7
Symbols QPC
QCR8
QP-C
UQCR7
MC3DN4

Gene

PANTHER Protein Class (2)

Gene RIF (4)

PMID Text
25950827 QP-C protein gene expression involved in the development of hyperpigmentation.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20440543 Decreased electron Transport Complex III activity is associated with ulcerative colitis.
18439546 We thus suggest that a homozygous mutation in UQCRQ is associated with defective function of mitochondrial complex III, leading to a severe autosomal-recessive neurological phenotype.

AA Sequence

MGREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERS      1 - 70
KRKNPAAYENDK                                                               71 - 82
//

Text Mined References (12)

PMID Year Title
25950827 2015 Identification of Genes Expressed in Hyperpigmented Skin Using Meta-Analysis of Microarray Data Sets.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20440543 2010 Mitochondrial respiratory chain in the colonic mucosal of patients with ulcerative colitis.
18439546 2008 Mitochondrial complex III deficiency associated with a homozygous mutation in UQCRQ.
15544925 2004 Oxidative modification of mitochondrial respiratory complexes in response to the stress of Trypanosoma cruzi infection.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...