Property Summary

NCBI Gene PubMed Count 9
PubMed Score 33.16
PubTator Score 11.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma 1.600 8.1e-05
Astrocytoma, Pilocytic 2.100 5.4e-09
cutaneous lupus erythematosus 3.600 2.7e-04
glioblastoma 1.600 8.9e-06
group 3 medulloblastoma 1.100 8.1e-03
head and neck cancer and chronic obstruc... 1.900 1.7e-03
inflammatory breast cancer 1.300 2.3e-02
interstitial cystitis 3.100 5.3e-03
invasive ductal carcinoma 1.504 8.8e-05
lung cancer -1.600 7.5e-03
lung carcinoma -2.700 2.5e-22
nasopharyngeal carcinoma 1.100 2.8e-02
non primary Sjogren syndrome sicca -1.100 2.3e-02
non-small cell lung cancer -1.660 2.1e-11
osteosarcoma -1.885 3.3e-02
ovarian cancer -1.400 3.0e-03
posterior fossa group A ependymoma 1.200 1.9e-04
Rheumatoid arthritis 1.300 2.2e-02
ulcerative colitis 1.100 1.6e-03

Gene RIF (1)

AA Sequence

MTLDHQIINPTLKWSQPAVPSGGPLVQHAHTTLDSDAGLTENPLTKLLAIGKEDDNAQWHMEDVIEDIIG      1 - 70
MESSFKEEGADSPLLMQRTLSGSILDVYSGEQGISPINMGLTSASCPSSLPMKREITETDTRALAKERQK     71 - 140
KDNHNLIERRRRYNINYRIKELGTLIPKSNDPDMRWNKGTILKASVEYIKWLQKEQQRARELEHRQKKLE    141 - 210
QANRRLLLRIQELEIQARTHGLPTLASLGTVDLGAHVTKQQSHPEQNSVDYCQQLTVSQGPSPELCDQAI    211 - 280
AFSDPLSYFTDLSFSAALKEEQRLDGMLLDDTISPFGTDPLLSATSPAVSKESSRRSSFSSDDGDEL       281 - 347
//

Text Mined References (13)

PMID Year Title