Property Summary

NCBI Gene PubMed Count 51
Grant Count 62
R01 Count 45
Funding $6,629,334.55
PubMed Score 177.91
PubTator Score 65.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Rheumatoid Arthritis 2.000 0.029
gastric cancer -1.700 0.006
hepatocellular carcinoma -2.300 0.001
psoriasis 1.900 0.000
cutaneous lupus erythematosus 1.100 0.036
cystic fibrosis 1.400 0.002
Atopic dermatitis -2.200 0.012
tuberculosis and treatment for 3 months -3.300 0.006
lung cancer -2.200 0.000
active Crohn's disease -1.281 0.044
pancreatic cancer 2.000 0.001
interstitial cystitis 2.700 0.029
non primary Sjogren syndrome sicca -1.100 0.019
inflammatory breast cancer -1.200 0.006
spina bifida -2.711 0.032
mucosa-associated lymphoid tissue lympho... -1.475 0.016
acute myeloid leukemia -3.800 0.003
ulcerative colitis 1.800 0.010

Synonym

Accession O14944 B2RC66 Q6FH69
Symbols ER
Ep
EPR

Gene

PANTHER Protein Class (2)

PDB

1K36   1K37   5E8D  

Gene RIF (35)

PMID Text
26627827 three-dimensional structure of the EPR antibody (the 9E5(Fab) fragment) in the presence and absence of EPR
26215578 Together, these studies lead to identification of a novel pathway involving EREG and MMP-1 that contributes to the formation of early stage breast cancer
25203737 Patients homozygous for the minor allele A of EREG rs12641042 had a significantly higher 3-year survival rate than patients with allele C (HR 0.48; P=0.034), but significance was lost in multivariable analysis
24898387 Data indicate that the effects of epiregulin (EREG) and V-ATPase (TCIRG1) single nucleotide polymorphism (SNP) on pulmonary tuberculosis susceptibility, to the extent that they exist, are dependent on gene-gene interactions in West African populations.
24812054 Epiregulin promotes the proliferation of liver progenitor cells and DNA synthesis by hepatocytes and is upregulated in the serum of patients with liver injury.
24800946 Plasma HGF and EREG levels are associated with resistance to treatment with anti-EGFR antibodies in KRAS wild-type patients with metastatic colorectal cancer.
24748662 Epiregulin is a transcriptional target of TSC2 (tuberin).
24470554 These results suggested that EREG is one of the molecules involved in glioma malignancy
24335920 In pre-treated K-ras wild-type status colorectal cancer, patients with high EREG gene expression appear to benefit more from cetuximab therapy compared with low expression.
24330607 EREG may contribute to glioma progression under the control of IRE1a.
More...

AA Sequence

MTAGRRMEMLCAGRVPALLLCLGFHLLQAVLSTTVIPSCIPGESSDNCTALVQTEDNPRVAQVSITKCSS      1 - 70
DMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFLTVHQPLSKEYVALTVILIILFLITVVGSTYYF     71 - 140
CRWYRNRKSKEPKKEYERVTSGDPELPQV                                             141 - 169
//

Text Mined References (54)

PMID Year Title
26627827 2016 Epiregulin Recognition Mechanisms by Anti-epiregulin Antibody 9E5: STRUCTURAL, FUNCTIONAL, AND MOLECULAR DYNAMICS SIMULATION ANALYSES.
26215578 2015 Epiregulin contributes to breast tumorigenesis through regulating matrix metalloproteinase 1 and promoting cell survival.
25952286 2015 BMP7 and EREG Contribute to the Inductive Potential of Dental Mesenchyme.
25911599 2015 Altered amphiregulin expression induced by diverse luteinizing hormone receptor reactivity in granulosa cells affects IVF outcomes.
25421577 2015 KAP1 promotes proliferation and metastatic progression of breast cancer cells.
25203737 2014 Single nucleotide polymorphisms in AREG and EREG are prognostic biomarkers in locally advanced gastric cancer patients after surgery with curative intent.
24898387 2014 Epiregulin (EREG) and human V-ATPase (TCIRG1): genetic variation, ethnicity and pulmonary tuberculosis susceptibility in Guinea-Bissau and The Gambia.
24812054 2014 Epiregulin promotes the emergence and proliferation of adult liver progenitor cells.
24800946 2014 Serum levels of hepatocyte growth factor and epiregulin are associated with the prognosis on anti-EGFR antibody treatment in KRAS wild-type metastatic colorectal cancer.
24748662 2014 Evidence that TSC2 acts as a transcription factor and binds to and represses the promoter of Epiregulin.
More...