Property Summary

NCBI Gene PubMed Count 56
PubMed Score 183.26
PubTator Score 65.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
active Crohn's disease -1.281 4.4e-02
acute myeloid leukemia -3.800 3.2e-03
Atopic dermatitis -2.200 1.2e-02
cutaneous lupus erythematosus 1.100 3.6e-02
cystic fibrosis 1.399 4.4e-04
gastric cancer -1.700 6.3e-03
hepatocellular carcinoma -2.300 1.3e-03
inflammatory breast cancer -1.200 5.7e-03
interstitial cystitis 2.700 2.9e-02
lung cancer -1.600 3.8e-03
mucosa-associated lymphoid tissue lympho... -1.475 1.6e-02
non primary Sjogren syndrome sicca -1.100 1.9e-02
pancreatic cancer 2.000 6.4e-04
psoriasis 1.900 5.2e-06
Rheumatoid arthritis 2.000 2.9e-02
spina bifida -2.711 3.2e-02
tuberculosis -2.100 6.4e-04
ulcerative colitis 1.800 1.0e-02

Protein-protein Interaction (3)

Gene RIF (40)

AA Sequence

MTAGRRMEMLCAGRVPALLLCLGFHLLQAVLSTTVIPSCIPGESSDNCTALVQTEDNPRVAQVSITKCSS      1 - 70
DMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFLTVHQPLSKEYVALTVILIILFLITVVGSTYYF     71 - 140
CRWYRNRKSKEPKKEYERVTSGDPELPQV                                             141 - 169
//

Text Mined References (59)

PMID Year Title