Property Summary

NCBI Gene PubMed Count 130
Grant Count 121
R01 Count 80
Funding $10,994,745.68
PubMed Score 289.19
PubTator Score 147.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

Synonym

Gene

MLP Assay (10)

AID Type Active / Inconclusive / Inactive Description
602143 screening 56 / 0 / 368 Cellular PLD2 isoenzyme activity assays at a set concentration
602147 confirmatory 147 / 0 / 0 Cellular PLD2 concentration response
602149 confirmatory 25 / 0 / 0 PLD2 purified enzyme concentration response
602153 other 3 / 0 / 0 ML270, ML271, ML272 Competition in Radioligand Binding assays (Ricerca)
624000 confirmatory 2 / 0 / 0 PLD2 purified enzyme concentration response (PLD2_Assay_3B_Lib32)
624004 confirmatory 10 / 0 / 0 PLD2 Cellular concentration response (PLD2_Assay_2B_Lib32)
624009 screening 9 / 0 / 19 PLD2 Cellular isoenzyme activity (PLD2_Assay_1B_Lib32)
743391 confirmatory 3 / 0 / 0 Discovery of PLD2 inhibitors using the Purified Enzyme Concentration Response Assay
743400 confirmatory 21 / 0 / 0 PLD2 Cellular Concentration Response Study
743409 screening 23 / 0 / 57 Identifying inhibitors with PLD2 specific Cellular Isoenzyme Activity

Gene RIF (96)

PMID Text
26611735 PLD2 protein itself interacts with HIF-1alpha, prolyl hydroxylase (PHD) and VHL to promote degradation of HIF-1alpha via the proteasomal pathway independent of lipase activity.
26124282 PLD2-mediated production of phosphatidic acid contributed to the control of EGFR exposure to ligand through a multipronged transcriptional and posttranscriptional program during the out-of-control accumulation of EGFR signaling in cancer cells.
25523098 Ectopic expression of PLD1 or PLD2 in human glioma U87 cells increased the expression of hypoxia-inducible factor-1alpha protein.
25475140 Knockdown of PLD2 induces autophagy in colorectal cancer cells.
25432699 These results suggest that PLD2 expression in colon cancer cells is up-regulated via HIF1-alpha in response to hypoxic stress and underscores the crucial role of HIF1-alpha-induced PLD2 in tumor growth.
25354038 PLD2 expression regulates formation of Golgi tubules in Hela cells.
25308783 A 3D model of the PLD2 by combining homology and ab initio 3 dimensional structural modeling methods, and docking conformation, is reported.
25197053 PLD2, but not PLD1, directly binds to the C terminus of TREK1 and TREK2.
25172550 Results indicate distinctive roles of phospholipase D PLD1 and PLD2 isoforms in pathological conditions in retinal pigment epithelium (RPE).
25065577 Inhibition of PLD2 accelerated the accumulation of MxA in foci as early as 30 min postinfection. .. PLD facilitates the rapid endocytosis of influenza virus, permitting viral escape from innate immune detection
More...

AA Sequence

MTATPESLFPTGDELDSSQLQMESDEVDTLKEGEDPADRMHPFLAIYELQSLKVHPLVFAPGVPVTAQVV      1 - 70
GTERYTSGSKVGTCTLYSVRLTHGDFSWTTKKKYRHFQELHRDLLRHKVLMSLLPLARFAVAYSPARDAG     71 - 140
NREMPSLPRAGPEGSTRHAASKQKYLENYLNRLLTMSFYRNYHAMTEFLEVSQLSFIPDLGRKGLEGMIR    141 - 210
KRSGGHRVPGLTCCGRDQVCYRWSKRWLVVKDSFLLYMCLETGAISFVQLFDPGFEVQVGKRSTEARHGV    211 - 280
RIDTSHRSLILKCSSYRQARWWAQEITELAQGPGRDFLQLHRHDSYAPPRPGTLARWFVNGAGYFAAVAD    281 - 350
AILRAQEEIFITDWWLSPEVYLKRPAHSDDWRLDIMLKRKAEEGVRVSILLFKEVELALGINSGYSKRAL    351 - 420
MLLHPNIKVMRHPDQVTLWAHHEKLLVVDQVVAFLGGLDLAYGRWDDLHYRLTDLGDSSESAASQPPTPR    421 - 490
PDSPATPDLSHNQFFWLGKDYSNLITKDWVQLDRPFEDFIDRETTPRMPWRDVGVVVHGLPARDLARHFI    491 - 560
QRWNFTKTTKAKYKTPTYPYLLPKSTSTANQLPFTLPGGQCTTVQVLRSVDRWSAGTLENSILNAYLHTI    561 - 630
RESQHFLYIENQFFISCSDGRTVLNKVGDEIVDRILKAHKQGWCYRVYVLLPLLPGFEGDISTGGGNSIQ    631 - 700
AILHFTYRTLCRGEYSILHRLKAAMGTAWRDYISICGLRTHGELGGHPVSELIYIHSKVLIADDRTVIIG    701 - 770
SANINDRSLLGKRDSELAVLIEDTETEPSLMNGAEYQAGRFALSLRKHCFGVILGANTRPDLDLRDPICD    771 - 840
DFFQLWQDMAESNANIYEQIFRCLPSNATRSLRTLREYVAVEPLATVSPPLARSELTQVQGHLVHFPLKF    841 - 910
LEDESLLPPLGSKEGMIPLEVWT                                                   911 - 933
//

Text Mined References (133)

PMID Year Title
26611735 2015 Phospholipase D2 promotes degradation of hypoxia-inducible factor-1? independent of lipase activity.
26124282 2015 Phosphatidic Acid Increases Epidermal Growth Factor Receptor Expression by Stabilizing mRNA Decay and by Inhibiting Lysosomal and Proteasomal Degradation of the Internalized Receptor.
25523098 2014 Phospholipase D activates HIF-1-VEGF pathway via phosphatidic acid.
25475140 2014 Inhibition of phospholipase D2 induces autophagy in colorectal cancer cells.
25432699 2015 Hypoxia-inducible factor 1-alpha up-regulates the expression of phospholipase D2 in colon cancer cells under hypoxic conditions.
25354038 2014 Phospholipase D2 is involved in the formation of Golgi tubules and ArfGAP1 recruitment.
25308783 2015 Mechanism of enzymatic reaction and protein-protein interactions of PLD from a 3D structural model.
25197053 2014 Phospholipase D2 specifically regulates TREK potassium channels via direct interaction and local production of phosphatidic acid.
25172550 2014 The phospholipase D pathway mediates the inflammatory response of the retinal pigment epithelium.
25065577 2014 Phospholipase D facilitates efficient entry of influenza virus, allowing escape from innate immune inhibition.
More...