Property Summary

NCBI Gene PubMed Count 77
Grant Count 105
R01 Count 69
Funding $8,835,824.11
PubMed Score 127.39
PubTator Score 112.97

Knowledge Summary

Patent (9,697)

Expression

Synonym

Accession O14936 A6NES1 B7ZKY0 O43215 Q17RI4 Q59HA0 Q5VT16 Q5VT17 Q5VT18 Q5VT19 Q66T42 Q9BYH6 Q9NYB2 Q9NYB3 hCASK
Symbols CMG
FGS4
LIN2
TNRC8
CAGH39
CAMGUK
MICPCH
MRXSNA

Gene

PDB

3TAC   1KGD   1KWA   1ZL8   3C0G   3C0H   3C0I   3MFR   3MFS   3MFT   3MFU  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

Gene RIF (31)

PMID Text
25373785 In clinical specimens, CASK was over-expressed in tumors and H. pylori positive tissues, and its mRNA levels were inversely correlated with miR-203 expression.
24927672 Data indicate that patients with low calcium/calmodulin-dependent serine protein kinase (CASK) staining had a significantly better survival compared to patients with high CASK staining.
23864692 our findings suggest a molecular mechanism by which CASK binding regulates SAP97 conformation and its subsequent sorting and synaptic targeting of AMPARs and NMDARs during trafficking to synapses.
23600800 CASK represents an intracellular gateway to regulate purinergic nociceptive signaling.
23543616 CASK regulates CaMKII autophosphorylation in a pathway required for memory formation.
23542924 The findings suggest that CASK and the truncated prestin splice isoform contribute to confinement of prestin to the basolateral region of the plasma membrane.
23406872 a model whereby CASK recruits FRMD7 to the plasma membrane to promote neurite outgrowth during development of the oculomotor neural network and that defects in this interaction result in nystagmus.
23165780 An early diagnosis and be useful for medical care of females with ID and MICPCH associated with CASK mutations.
22709267 case reports - mutations resulting in Ohtahara syndrome and cerebellar hypoplasia
22452838 CASK related PCH is the second most frequent cause of PCH. The identification of a de novo mutation in these patients enables accurate and reassuring genetic counselling
More...

AA Sequence

MADDDVLFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTEDLKREASICHMLK      1 - 70
HPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASHYMRQILEALRYCHDNNIIHR     71 - 140
DVKPHCVLLASKENSAPVKLGGFGVAIQLGESGLVAGGRVGTPHFMAPEVVKREPYGKPVDVWGCGVILF    141 - 210
ILLSGCLPFYGTKERLFEGIIKGKYKMNPRQWSHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERD    211 - 280
RYAYKIHLPETVEQLRKFNARRKLKGAVLAAVSSHKFNSFYGDPPEELPDFSEDPTSSGLLAAERAVSQV    281 - 350
LDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEEISCYP    351 - 420
ENNDAKELKRILTQPHFMALLQTHDVVAHEVYSDEALRVTPPPTSPYLNGDSPESANGDMDMENVTRVRL    421 - 490
VQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMR    491 - 560
GSITFKIVPSYRTQSSSCERDSPSTSRQSPANGHSSTNNSVSDLPSTTQPKGRQIYVRAQFEYDPAKDDL    561 - 630
IPCKEAGIRFRVGDIIQIISKDDHNWWQGKLENSKNGTAGLIPSPELQEWRVACIAMEKTKQEQQASCTW    631 - 700
FGKKKKQYKDKYLAKHNAVFDQLDLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYP    701 - 770
IPHTTRPPKKDEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQ    771 - 840
ALKVLRTAEFAPFVVFIAAPTITPGLNEDESLQRLQKESDILQRTYAHYFDLTIINNEIDETIRHLEEAV    841 - 910
ELVCTAPQWVPVSWVY                                                          911 - 926
//

Text Mined References (83)

PMID Year Title
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25416956 2014 A proteome-scale map of the human interactome network.
25373785 2014 Down-regulation of miR-203 induced by Helicobacter pylori infection promotes the proliferation and invasion of gastric cancer by targeting CASK.
24927672 2014 High expression of CASK correlates with progression and poor prognosis of colorectal cancer.
24366813 2013 Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23864692 2013 CASK regulates SAP97 conformation and its interactions with AMPA and NMDA receptors.
23600800 2013 Calcium/calmodulin-dependent serine protein kinase (CASK) is a new intracellular modulator of P2X3 receptors.
23543616 2013 CASK and CaMKII function in the mushroom body ?'/?' neurons during Drosophila memory formation.
23542924 2013 Generation of somatic electromechanical force by outer hair cells may be influenced by prestin-CASK interaction at the basal junction with the Deiter's cell.
More...