Property Summary

Ligand Count 2
NCBI Gene PubMed Count 82
PubMed Score 130.24
PubTator Score 112.97

Knowledge Summary

Patent (9,697)

TINX Plot

  Disease (5)

Disease Target Count
FG syndrome 16
Absent speech 43
Animal Mammary Neoplasms 136
Axial hypotonia 46
Broad flat nasal bridge 236
Broad forehead 59
Broad nasal tip 28
Byzanthine arch palate 194
Cataract 297
Cerebellar Hypoplasia 61
Cerebral atrophy 178
Cognitive delay 608
Congenital Epicanthus 177
Convex nasal bridge 57
Dilated fourth ventricle 4
Dull intelligence 645
Early infantile epileptic encephalopathy with suppression bursts 10
Epilepsy 792
FG SYNDROME 4 (disorder) 1
Gait abnormality 135
Generalized hypotonia 37
Global developmental delay 608
Global developmental delay, severe 47
Globe of eye large 20
Hyperreflexia 209
Hypohidrosis 34
Hypoplastic mandible condyle 275
Increased size of palpebral fissures 9
Intellectual disability 1016
Large auricle 87
Large dysplastic ears 87
Large eyes 9
Large pinnae 87
Large prominent ears 87
Large protruding ears 87
Large, floppy ears 87
Lens Opacities 231
Long philtrum 137
Low Vision 174
Low intelligence 645
Macrotia 87
Mandibular hypoplasia 275
Mental Retardation 645
Mental and motor retardation 608
Mental deficiency 645
Micrognathism 275
Moderate mental retardation (I.Q. 35-49) 28
Muscle Spasticity 195
Muscle Weakness 170
Myopia 176
Nasal bridge wide 236
Nystagmus 317
Orbital separation excessive 244
Oval face 5
Poor school performance 645
Postnatal growth retardation 57
Progressive microcephaly 32
Prominent nasal bridge 57
Seizures 596
Sensorineural Hearing Loss (disorder) 284
Severe psychomotor retardation 47
Short nose 132
Short stature 531
Small head 374
Small nose 132
Strabismus 270
Underweight 17
Visual Impairment 174
Weight decreased 103
Weight less than 3rd percentile 17
X-linked dominant 57
nonverbal 43
Disease Target Count Z-score Confidence
Congenital nystagmus 26 3.538 1.8
Lobular neoplasia 15 3.418 1.7
Disease Target Count
Fg Syndrome 4 1

Expression

Gene RIF (36)

AA Sequence

MADDDVLFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTEDLKREASICHMLK      1 - 70
HPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASHYMRQILEALRYCHDNNIIHR     71 - 140
DVKPHCVLLASKENSAPVKLGGFGVAIQLGESGLVAGGRVGTPHFMAPEVVKREPYGKPVDVWGCGVILF    141 - 210
ILLSGCLPFYGTKERLFEGIIKGKYKMNPRQWSHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERD    211 - 280
RYAYKIHLPETVEQLRKFNARRKLKGAVLAAVSSHKFNSFYGDPPEELPDFSEDPTSSGLLAAERAVSQV    281 - 350
LDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEEISCYP    351 - 420
ENNDAKELKRILTQPHFMALLQTHDVVAHEVYSDEALRVTPPPTSPYLNGDSPESANGDMDMENVTRVRL    421 - 490
VQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMR    491 - 560
GSITFKIVPSYRTQSSSCERDSPSTSRQSPANGHSSTNNSVSDLPSTTQPKGRQIYVRAQFEYDPAKDDL    561 - 630
IPCKEAGIRFRVGDIIQIISKDDHNWWQGKLENSKNGTAGLIPSPELQEWRVACIAMEKTKQEQQASCTW    631 - 700
FGKKKKQYKDKYLAKHNAVFDQLDLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYP    701 - 770
IPHTTRPPKKDEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQ    771 - 840
ALKVLRTAEFAPFVVFIAAPTITPGLNEDESLQRLQKESDILQRTYAHYFDLTIINNEIDETIRHLEEAV    841 - 910
ELVCTAPQWVPVSWVY                                                          911 - 926
//

Text Mined References (89)

PMID Year Title