Property Summary

NCBI Gene PubMed Count 33
PubMed Score 13.92
PubTator Score 21.77

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (16)

Disease log2 FC p
active Crohn's disease 2.319 1.3e-03
active ulcerative colitis 1.725 2.4e-03
cutaneous lupus erythematosus 2.200 6.5e-05
dermatomyositis 1.900 7.8e-03
esophageal adenocarcinoma 1.100 2.0e-02
interstitial cystitis 1.200 4.4e-03
invasive ductal carcinoma 1.200 6.8e-03
juvenile dermatomyositis 2.896 5.2e-18
lung cancer -2.300 6.1e-06
medulloblastoma, large-cell -1.600 7.0e-04
Multiple myeloma 1.003 5.2e-03
Multiple Sclerosis 1.500 1.5e-02
osteosarcoma -1.096 1.8e-02
ovarian cancer 2.100 1.5e-04
psoriasis 1.200 5.6e-07
tuberculosis 1.900 6.1e-06

Protein-protein Interaction (5)

Gene RIF (7)

AA Sequence

MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKF      1 - 70
TTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNA     71 - 140
EEFTLRFGVDRPS                                                             141 - 153
//

Text Mined References (38)

PMID Year Title