Property Summary

NCBI Gene PubMed Count 32
PubMed Score 12.77
PubTator Score 21.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Multiple myeloma 1.003 0.005
esophageal adenocarcinoma 1.100 0.020
psoriasis 1.600 0.000
cutaneous lupus erythematosus 2.200 0.000
osteosarcoma -1.096 0.018
medulloblastoma, large-cell -1.600 0.001
juvenile dermatomyositis 2.896 0.000
tuberculosis 1.900 0.000
lung cancer -2.300 0.000
active Crohn's disease 2.319 0.001
ulcerative colitis 2.200 0.000
Multiple Sclerosis 1.500 0.015
interstitial cystitis 1.200 0.004
invasive ductal carcinoma 1.200 0.007
ovarian cancer 2.100 0.000
dermatomyositis 1.900 0.008

Synonym

Accession O14933 A6NDM6 A8MY53 Q8N5D8 Q9UEZ0
Symbols RIG-B
UBCH8

Gene

PANTHER Protein Class (1)

PDB

2KJH   1WZV   1WZW  

Gene RIF (6)

PMID Text
26506425 Data indicate that reduced expression of the ubiquitin-conjugating enzyme UbcH8 protein correlated with poor outcome in nasopharyngeal carcinoma (NPC) patients.
21628527 study reports that UBCH8 and UBE2G1 and UBE2G2 cooperate with CRL4Cdt2 in promoting the polyubiquitylation and subsequent degradation of p21 and Cdt1, respectively
20508617 gain and loss-of-function approaches show that UBCH8 and the ubiquitin-ligase SIAH1 physically interact with and target FLT3-ITD for proteasomal degradation
19928833 The structure of UbcH8 does not undergo a significant conformational change upon forming a complex with ubiquitin.
18583345 Ube1L was required for transfer of ISG15 to UbcH8 and for binding of Ube1L to UbcH8
15670748 Quantitative-PCR and Northern analysis confirmed down-regulation of UCRP and UBE2L6 with BRCA2 knockdown, respectively.

AA Sequence

MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKF      1 - 70
TTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNA     71 - 140
EEFTLRFGVDRPS                                                             141 - 153
//

Text Mined References (37)

PMID Year Title
26506425 2015 Epigenetic downregulation of the ISG15-conjugating enzyme UbcH8 impairs lipolysis and correlates with poor prognosis in nasopharyngeal carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
24446487 2014 E2~Ub conjugates regulate the kinase activity of Shigella effector OspG during pathogenesis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21628527 2011 Selective ubiquitylation of p21 and Cdt1 by UBCH8 and UBE2G ubiquitin-conjugating enzymes via the CRL4Cdt2 ubiquitin ligase complex.
21269460 2011 Initial characterization of the human central proteome.
20508617 2010 Ubiquitin conjugase UBCH8 targets active FMS-like tyrosine kinase 3 for proteasomal degradation.
19928833 2009 The structure of the UbcH8-ubiquitin complex shows a unique ubiquitin interaction site.
19690564 2009 A comprehensive framework of E2-RING E3 interactions of the human ubiquitin-proteasome system.
19549727 2009 Analysis of the human E2 ubiquitin conjugating enzyme protein interaction network.
More...