Property Summary

NCBI Gene PubMed Count 75
PubMed Score 343.66
PubTator Score 178.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Expression

  Differential Expression (2)

Disease log2 FC p
tuberculosis 1.600 0.000
interstitial cystitis 1.400 0.009

Synonym

Accession O14931 B0S8F2 B0S8F4 B0S8F5 O14930 O14932 O95667 O95668 O95669 Q5ST89 Q5ST90 Q5ST91 Q5ST92 Q5STA3
Symbols 1C7
MALS
CD337
LY117
NKp30

Gene

PANTHER Protein Class (1)

PDB

3NOI   3PV6  

  Ortholog (6)

Gene RIF (60)

PMID Text
26582946 NKp30-B7-H6 interaction is a novel cell contact mechanism that mediates activation of Group 2 innate lymphoid cells and identifies a potential target for the development of novel therapeutics for atopic dermatitis and other atopic diseases.
26241657 Our results suggest that NKP30-B7-H6 interaction can aggravate hepatocyte damage, probably through up-regulation of IL-32 expression in hepatitis B virus-related acute-on-chronic liver failure
26094914 Suggest role for NKp30 isoforms in influencing liver damage and ensuing fibrosis in chronic hepatitis C infection.
25991472 Age and CMV serostatus influence the expression of NKp30, NKp46 and DNAM-1 activating receptors on resting and IL-2 activated natural killer cells.
25877893 the interaction between NKp30 and B7-H6 may contribute to the fate of neuroblastoma patients
25824372 show that in addition to NKG2D, human CEACAM1 can inhibit NK-cell activation via NKp30 or 2B4
25315772 Tumor-released Galectin-3, a soluble inhibitory ligand of human NKp30, plays an important role in tumor escape from NK cell attack.
25001651 Allogeneic and xenogeneic anti-tumor effect of callithrix jacchus natural killer cells is dependent on NKp30 and B7-H6 interaction.
24882570 Up-regulation of DNAM-1 and NKp30, associated with improvement of NK cells activation after long-term culture of mononuclear cells from patients with ovarian neoplasms.
24275655 Data indicate that the ectodomain of NKp30 forms functional homo-oligomers that mediate high affinity binding to its corresponding cellular ligand B7-H6.
More...

AA Sequence

MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGT      1 - 70
PEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVL     71 - 140
LLRAGFYAVSFLSVAVGSTVYYQGKCLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG             141 - 201
//

Text Mined References (75)

PMID Year Title
26582946 2016 Group 2 Innate Lymphoid Cells Express Functional NKp30 Receptor Inducing Type 2 Cytokine Production.
26241657 2015 NKP30-B7-H6 Interaction Aggravates Hepatocyte Damage through Up-Regulation of Interleukin-32 Expression in Hepatitis B Virus-Related Acute-On-Chronic Liver Failure.
26094914 2015 NKp30 isoforms in patients with chronic hepatitis C virus infection.
25991472 2015 Expression of NKp30, NKp46 and DNAM-1 activating receptors on resting and IL-2 activated NK cells from healthy donors according to CMV-serostatus and age.
25877893 2015 Clinical impact of the NKp30/B7-H6 axis in high-risk neuroblastoma patients.
25824372 2015 Inhibition of NKp30- and 2B4-mediated NK cell activation by evolutionary different human and bovine CEACAM1 receptors.
25315772 2014 Tumor-released Galectin-3, a soluble inhibitory ligand of human NKp30, plays an important role in tumor escape from NK cell attack.
25001651 Allogeneic and xenogeneic anti-tumor effect of callithrix jacchus natural killer cells is dependent on NKp30 and B7-H6 interaction.
24882570 2014 Up-regulation of DNAM-1 and NKp30, associated with improvement of NK cells activation after long-term culture of mononuclear cells from patients with ovarian neoplasia.
24275655 2014 Homo-oligomerization of the activating natural killer cell receptor NKp30 ectodomain increases its binding affinity for cellular ligands.
More...