Property Summary

NCBI Gene PubMed Count 80
PubMed Score 374.67
PubTator Score 178.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Malaria 160 0.0 0.0
Disease Target Count P-value
tuberculosis 2010 2.9e-04
interstitial cystitis 2312 3.6e-03

Expression

  Differential Expression (2)

Disease log2 FC p
interstitial cystitis 1.200 3.6e-03
tuberculosis 1.200 2.9e-04

 CSPA Cell Line (1)

Gene RIF (65)

AA Sequence

MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGT      1 - 70
PEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVL     71 - 140
LLRAGFYAVSFLSVAVGSTVYYQGKCLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG             141 - 201
//

Text Mined References (80)

PMID Year Title