Property Summary

NCBI Gene PubMed Count 75
Grant Count 31
R01 Count 13
Funding $3,386,757.81
PubMed Score 343.66
PubTator Score 178.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
tuberculosis 1.600 0.000
interstitial cystitis 1.400 0.009

Gene RIF (60)

PMID Text
26582946 NKp30-B7-H6 interaction is a novel cell contact mechanism that mediates activation of Group 2 innate lymphoid cells and identifies a potential target for the development of novel therapeutics for atopic dermatitis and other atopic diseases.
26241657 Our results suggest that NKP30-B7-H6 interaction can aggravate hepatocyte damage, probably through up-regulation of IL-32 expression in hepatitis B virus-related acute-on-chronic liver failure
26094914 Suggest role for NKp30 isoforms in influencing liver damage and ensuing fibrosis in chronic hepatitis C infection.
25991472 Age and CMV serostatus influence the expression of NKp30, NKp46 and DNAM-1 activating receptors on resting and IL-2 activated natural killer cells.
25877893 the interaction between NKp30 and B7-H6 may contribute to the fate of neuroblastoma patients
25824372 show that in addition to NKG2D, human CEACAM1 can inhibit NK-cell activation via NKp30 or 2B4
25315772 Tumor-released Galectin-3, a soluble inhibitory ligand of human NKp30, plays an important role in tumor escape from NK cell attack.
25001651 Allogeneic and xenogeneic anti-tumor effect of callithrix jacchus natural killer cells is dependent on NKp30 and B7-H6 interaction.
24882570 Up-regulation of DNAM-1 and NKp30, associated with improvement of NK cells activation after long-term culture of mononuclear cells from patients with ovarian neoplasms.
24275655 Data indicate that the ectodomain of NKp30 forms functional homo-oligomers that mediate high affinity binding to its corresponding cellular ligand B7-H6.
More...

AA Sequence

MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGT      1 - 70
PEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVL     71 - 140
LLRAGFYAVSFLSVAVGSTVYYQGKCLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG             141 - 201
//

Text Mined References (75)

PMID Year Title
26582946 2016 Group 2 Innate Lymphoid Cells Express Functional NKp30 Receptor Inducing Type 2 Cytokine Production.
26241657 2015 NKP30-B7-H6 Interaction Aggravates Hepatocyte Damage through Up-Regulation of Interleukin-32 Expression in Hepatitis B Virus-Related Acute-On-Chronic Liver Failure.
26094914 2015 NKp30 isoforms in patients with chronic hepatitis C virus infection.
25991472 2015 Expression of NKp30, NKp46 and DNAM-1 activating receptors on resting and IL-2 activated NK cells from healthy donors according to CMV-serostatus and age.
25877893 2015 Clinical impact of the NKp30/B7-H6 axis in high-risk neuroblastoma patients.
25824372 2015 Inhibition of NKp30- and 2B4-mediated NK cell activation by evolutionary different human and bovine CEACAM1 receptors.
25315772 2014 Tumor-released Galectin-3, a soluble inhibitory ligand of human NKp30, plays an important role in tumor escape from NK cell attack.
25001651 Allogeneic and xenogeneic anti-tumor effect of callithrix jacchus natural killer cells is dependent on NKp30 and B7-H6 interaction.
24882570 2014 Up-regulation of DNAM-1 and NKp30, associated with improvement of NK cells activation after long-term culture of mononuclear cells from patients with ovarian neoplasia.
24275655 2014 Homo-oligomerization of the activating natural killer cell receptor NKp30 ectodomain increases its binding affinity for cellular ligands.
More...