Property Summary

NCBI Gene PubMed Count 25
Grant Count 26
R01 Count 23
Funding $3,256,919.82
PubMed Score 20.95
PubTator Score 50.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.556 0.014
Multiple myeloma 2.043 0.001
astrocytoma 1.200 0.000
glioblastoma 1.700 0.000
oligodendroglioma 1.200 0.000
ependymoma 1.600 0.000
primitive neuroectodermal tumor 1.100 0.001
pediatric high grade glioma 1.400 0.000
Polycystic Ovary Syndrome 1.004 0.037
progressive supranuclear palsy -1.600 0.009
ovarian cancer 2.500 0.000
dermatomyositis 1.700 0.008

Gene RIF (9)

PMID Text
26654953 These data indicated that miR-486 aggravate the cholesterol accumulation in THP-1 cells by targeting HAT1.
25120766 The expression of HAT1 was higher in the primary Esophageal carcinoma tumors and adjacent tissue as compared to that of the normal esophageal tissue and HAT1 expression was directly correlated with the poor tumor differentiation
24116224 HIV-1 Vpr forms a complex by recruiting RbAp46, HAT1, ZIP/sZIP, and Cul4A
23653357 Data indicate that HAT1 is required for homologous recombination in DNA repair.
22228774 HAT1 differentially impacts nucleosome assembly of H3.1-H4 and H3.3-H4.
22190034 HIV-1 Vpr forms a complex by recruiting RbAp46, HAT1, ZIP/sZIP, and Cul4A
18458078 HAT gene expression is required for cisplatin resistance and Clock and Tip60 regulate not only transcription, but also DNA repair, through periodic histone acetylation
17052979 the role of Hat1 in DNA damage repair is evolutionarily conserved, the ability of H3 acetylation to compensate for Hat1 deletion appears to be more variable
12775419 HIV-1 Vpr forms a complex by recruiting RbAp46, HAT1, ZIP/sZIP, and Cul4A

AA Sequence

MAGFGAMEKFLVEYKSAVEKKLAEYKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLFGDDETAFGYK      1 - 70
GLKILLYYIAGSLSTMFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFCTNTNDFLSLLEKEVDFKPFG     71 - 140
TLLHTYSVLSPTGGENFTFQIYKADMTCRGFREYHERLQTFLMWFIETASFIDVDDERWHYFLVFEKYNK    141 - 210
DGATLFATVGYMTVYNYYVYPDKTRPRVSQMLILTPFQGQGHGAQLLETVHRYYTEFPTVLDITAEDPSK    211 - 280
SYVKLRDFVLVKLCQDLPCFSREKLMQGFNEDMAIEAQQKFKINKQHARRVYEILRLLVTDMSDAEQYRS    281 - 350
YRLDIKRRLISPYKKKQRDLAKMRKCLRPEELTNQMNQIEISMQHEQLEESFQELVEDYRRVIERLAQE     351 - 419
//

Text Mined References (33)

PMID Year Title
26654953 2016 MiR-486 regulates cholesterol efflux by targeting HAT1.
25416956 2014 A proteome-scale map of the human interactome network.
25120766 2014 RNAi screening identifies HAT1 as a potential drug target in esophageal squamous cell carcinoma.
23653357 2013 Histone acetyltransferase 1 promotes homologous recombination in DNA repair by facilitating histone turnover.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22615379 2012 Structural basis for substrate specificity and catalysis of human histone acetyltransferase 1.
22228774 2012 Human histone acetyltransferase 1 protein preferentially acetylates H4 histone molecules in H3.1-H4 over H3.3-H4.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22190034 2011 Global landscape of HIV-human protein complexes.
21269460 2011 Initial characterization of the human central proteome.
More...