Property Summary

NCBI Gene PubMed Count 28
PubMed Score 23.14
PubTator Score 50.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytoma 1.200 7.7e-19
dermatomyositis 1.700 8.1e-03
ependymoma 1.600 3.6e-15
glioblastoma 1.200 1.1e-06
Multiple myeloma 2.043 1.1e-03
oligodendroglioma 1.200 3.9e-12
ovarian cancer 2.500 1.5e-04
pediatric high grade glioma 1.400 1.5e-05
Polycystic ovary syndrome 1.004 3.7e-02
primitive neuroectodermal tumor 1.100 6.9e-04
progressive supranuclear palsy -1.600 8.8e-03
Waldenstrons macroglobulinemia 1.556 1.4e-02

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (12)

AA Sequence

MAGFGAMEKFLVEYKSAVEKKLAEYKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLFGDDETAFGYK      1 - 70
GLKILLYYIAGSLSTMFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFCTNTNDFLSLLEKEVDFKPFG     71 - 140
TLLHTYSVLSPTGGENFTFQIYKADMTCRGFREYHERLQTFLMWFIETASFIDVDDERWHYFLVFEKYNK    141 - 210
DGATLFATVGYMTVYNYYVYPDKTRPRVSQMLILTPFQGQGHGAQLLETVHRYYTEFPTVLDITAEDPSK    211 - 280
SYVKLRDFVLVKLCQDLPCFSREKLMQGFNEDMAIEAQQKFKINKQHARRVYEILRLLVTDMSDAEQYRS    281 - 350
YRLDIKRRLISPYKKKQRDLAKMRKCLRPEELTNQMNQIEISMQHEQLEESFQELVEDYRRVIERLAQE     351 - 419
//

Text Mined References (36)

PMID Year Title