Property Summary

NCBI Gene PubMed Count 22
Grant Count 8
R01 Count 4
Funding $442,338.51
PubMed Score 0.00
PubTator Score 17.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell -1.300 0.000
adult high grade glioma -1.100 0.001

Gene RIF (15)

PMID Text
26363219 Tax-mediated transcriptional induction of Fascin requires NF-kappaB- and TRR-dependent promoter activation, and a promoter-independent, but PP2-sensitive signaling pathway.
24414419 Data indicate the specific contribution of fascin and cortactin during invadopodium formation.
24070574 the serum fascin level is an effective indicator of tumor aggressiveness, and that it plays an important role in the prognosis of NSCLC, particularly for non-distant metastatic patients.
21975552 The filopodium: a stable structure with highly regulated repetitive cycles of elongation and persistence depending on the actin cross-linker fascin
20410808 Fascin expression predicts survival after potentially curative resection of node-positive colon cancer.
19473443 expression may play an essential role in regulation of progression of oral squamous cell carcinoma and contributes to the event of epithelial-mesenchymal transition in the early aggressiveness of OSCC
19207554 Higher fascin scores correlated positively with tumor differentiation of esophageal SqCC. Significantly worse prognosis in patients with high scores of fascin, poor differentiation, T4 stage, positive for lymph node metastasis and distant metastasis
18498068 In ovarian tumors fascin is associated with certain features of increased tumor aggressiveness.
18450588 Real-time PCR-based genotyping method developed here is useful for investigations of allelic asymmetries within genomic regions with variations found in retinitis pigmentosa and retinl degeneration.
18450588 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MPTNGLHQVLKIQFGLVNDTDRYLTAESFGFKVNASAPSLKRKQTWVLEPDPGQGTAVLLRSSHLGRYLS      1 - 70
AEEDGRVACEAEQPGRDCRFLVLPQPDGRWVLRSEPHGRFFGGTEDQLSCFATAVSPAELWTVHLAIHPQ     71 - 140
AHLLSVSRRRYVHLCPREDEMAADGDKPWGVDALLTLIFRSRRYCLKSCDSRYLRSDGRLVWEPEPRACY    141 - 210
TLEFKAGKLAFKDCDGHYLAPVGPAGTLKAGRNTRPGKDELFDLEESHPQVVLVAANHRYVSVRQGVNVS    211 - 280
ANQDDELDHETFLMQIDQETKKCTFYSSTGGYWTLVTHGGIHATATQVSANTMFEMEWRGRRVALKASNG    281 - 350
RYVCMKKNGQLAAISDFVGKDEEFTLKLINRPILVLRGLDGFVCHHRGSNQLDTNRSVYDVFHLSFSDGA    351 - 420
YRIRGRDGGFWYTGSHGSVCSDGERAEDFVFEFRERGRLAIRARSGKYLRGGASGLLRADADAPAGTALW    421 - 490
EY                                                                        491 - 492
//

Text Mined References (22)

PMID Year Title
26363219 2015 Regulation of the tumor marker Fascin by the viral oncoprotein Tax of human T-cell leukemia virus type 1 (HTLV-1) depends on promoter activation and on a promoter-independent mechanism.
24414419 2014 Stratifying fascin and cortactin function in invadopodium formation using inhibitory nanobodies and targeted subcellular delocalization.
24070574 2013 Serological investigation of the clinical significance of fascin in non-small-cell lung cancer.
21975552 The filopodium: a stable structure with highly regulated repetitive cycles of elongation and persistence depending on the actin cross-linker fascin.
20410808 2010 Fascin expression predicts survival after potentially curative resection of node-positive colon cancer.
19473443 2009 Effects of small interfering RNAs targeting Fascin on gene expression in oral cancer cells.
19207554 2009 Cortactin, fascin, and survivin expression associated with clinicopathological parameters in esophageal squamous cell carcinoma.
18498068 2008 Fascin in ovarian epithelial tumors.
18450588 2008 Allelic copy number variation in FSCN2 detected using allele-specific genotyping and multiplex real-time PCRs.
17286855 2007 Mapping of transcription start sites of human retina expressed genes.
More...