Property Summary

NCBI Gene PubMed Count 24
PubMed Score 8.83
PubTator Score 54.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.100 2.2e-03
Breast cancer 2.900 3.2e-02
lung cancer 1.100 5.3e-03
ovarian cancer 1.600 1.9e-04
pancreatic cancer 1.100 2.6e-02
pancreatic ductal adenocarcinoma liver m... -1.632 2.2e-02
psoriasis -1.600 2.2e-04
Rheumatoid arthritis -1.100 4.0e-02

Protein-protein Interaction (6)

Gene RIF (7)

AA Sequence

MEGGGGSGNKTTGGLAGFFGAGGAGYSHADLAGVPLTGMNPLSPYLNVDPRYLVQDTDEFILPTGANKTR      1 - 70
GRFELAFFTIGGCCMTGAAFGAMNGLRLGLKETQNMAWSKPRNVQILNMVTRQGALWANTLGSLALLYSA     71 - 140
FGVIIEKTRGAEDDLNTVAAGTMTGMLYKCTGGLRGIARGGLTGLTLTSLYALYNNWEHMKGSLLQQSL     141 - 209
//

Text Mined References (25)

PMID Year Title