Property Summary

NCBI Gene PubMed Count 23
Grant Count 5
R01 Count 5
Funding $1,411,595
PubMed Score 8.84
PubTator Score 54.99

Knowledge Summary

Patent

No data available

Gene RIF (6)

PMID Text
25519239 Modulating the sorting of nuclear-encoded proteins into mitochondria, mediated by the TIM23 complex, proves therapeutic in both yeast and patient-derived cells exhibiting ATP synthase deficiency.
24636990 Three distinct Tim23 complexes, namely, B1, B2, and A, are involved in the maintenance of normal mitochondrial function.
23811401 GST pull-down experiments and tryptophan fluorescence indicated that there is no interaction between Tim23IMS and Tim50IMS
23263864 MCJ functions as J co-chaperone of the human TIM23 pre-protein translocase.
23260140 Study establishes an unexpected molecular link between the TIM23 transport machinery and assembly of respiratory-chain complexes that regulate mitochondrial protein synthesis in response to their assembly state.
22306744 The non-bound hydrophilic domain of the human Tim23 is in a molten globule configuration with marginal stability, existing as a dimer.

AA Sequence

MEGGGGSGNKTTGGLAGFFGAGGAGYSHADLAGVPLTGMNPLSPYLNVDPRYLVQDTDEFILPTGANKTR      1 - 70
GRFELAFFTIGGCCMTGAAFGAMNGLRLGLKETQNMAWSKPRNVQILNMVTRQGALWANTLGSLALLYSA     71 - 140
FGVIIEKTRGAEDDLNTVAAGTMTGMLYKCTGGLRGIARGGLTGLTLTSLYALYNNWEHMKGSLLQQSL     141 - 209
//

Text Mined References (24)

PMID Year Title
25997101 2015 QIL1 is a novel mitochondrial protein required for MICOS complex stability and cristae morphology.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25519239 2014 Mitochondrial protein sorting as a therapeutic target for ATP synthase disorders.
24636990 2014 Unraveling the intricate organization of mammalian mitochondrial presequence translocases: existence of multiple translocases for maintenance of mitochondrial function.
23811401 2013 Interaction of presequence peptides with human translocase of inner membrane of mitochondria Tim23.
23263864 2013 Methylation-controlled J-protein MCJ acts in the import of proteins into human mitochondria.
23260140 2012 MITRAC links mitochondrial protein translocation to respiratory-chain assembly and translational regulation.
22306744 2012 The structural characteristics of human preprotein translocase of the inner mitochondrial membrane Tim23: implications for its physiological activities.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
20053669 2010 Role of Magmas in protein transport and human mitochondria biogenesis.
More...