Property Summary

NCBI Gene PubMed Count 23
PubMed Score 8.84
PubTator Score 54.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
ovarian cancer 8492 4.10701555729125E-5
psoriasis 6685 2.24660757212427E-4
adult high grade glioma 2148 0.002152390716621
lung cancer 4473 0.00532672227477314
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0216836539546702
pancreatic cancer 2300 0.0255833485033182
Breast cancer 3099 0.031990105748396
Rheumatoid Arthritis 1171 0.0402323403041324
Disease Target Count Z-score Confidence
Deafness dystonia syndrome 20 5.415 2.7
Dystonia 77 3.666 1.8

Synonym

Accession O14925 Q53FF8 Q5T1E6 Q6P5S5
Symbols TIM23

Gene

PANTHER Protein Class (2)

  Ortholog (4)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Cow OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (6)

PMID Text
25519239 Modulating the sorting of nuclear-encoded proteins into mitochondria, mediated by the TIM23 complex, proves therapeutic in both yeast and patient-derived cells exhibiting ATP synthase deficiency.
24636990 Three distinct Tim23 complexes, namely, B1, B2, and A, are involved in the maintenance of normal mitochondrial function.
23811401 GST pull-down experiments and tryptophan fluorescence indicated that there is no interaction between Tim23IMS and Tim50IMS
23263864 MCJ functions as J co-chaperone of the human TIM23 pre-protein translocase.
23260140 Study establishes an unexpected molecular link between the TIM23 transport machinery and assembly of respiratory-chain complexes that regulate mitochondrial protein synthesis in response to their assembly state.
22306744 The non-bound hydrophilic domain of the human Tim23 is in a molten globule configuration with marginal stability, existing as a dimer.

AA Sequence

MEGGGGSGNKTTGGLAGFFGAGGAGYSHADLAGVPLTGMNPLSPYLNVDPRYLVQDTDEFILPTGANKTR      1 - 70
GRFELAFFTIGGCCMTGAAFGAMNGLRLGLKETQNMAWSKPRNVQILNMVTRQGALWANTLGSLALLYSA     71 - 140
FGVIIEKTRGAEDDLNTVAAGTMTGMLYKCTGGLRGIARGGLTGLTLTSLYALYNNWEHMKGSLLQQSL     141 - 209
//

Text Mined References (24)

PMID Year Title
25997101 2015 QIL1 is a novel mitochondrial protein required for MICOS complex stability and cristae morphology.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25519239 2014 Mitochondrial protein sorting as a therapeutic target for ATP synthase disorders.
24636990 2014 Unraveling the intricate organization of mammalian mitochondrial presequence translocases: existence of multiple translocases for maintenance of mitochondrial function.
23811401 2013 Interaction of presequence peptides with human translocase of inner membrane of mitochondria Tim23.
23263864 2013 Methylation-controlled J-protein MCJ acts in the import of proteins into human mitochondria.
23260140 2012 MITRAC links mitochondrial protein translocation to respiratory-chain assembly and translational regulation.
22306744 2012 The structural characteristics of human preprotein translocase of the inner mitochondrial membrane Tim23: implications for its physiological activities.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
20053669 2010 Role of Magmas in protein transport and human mitochondria biogenesis.
More...