Property Summary

NCBI Gene PubMed Count 19
Grant Count 36
R01 Count 23
Funding $2,007,752.96
PubMed Score 23.54
PubTator Score 14.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
posterior fossa group A ependymoma -1.300 0.000
oligodendroglioma 1.200 0.002
psoriasis 1.800 0.000
osteosarcoma -1.517 0.000
atypical teratoid / rhabdoid tumor -1.200 0.001
glioblastoma -1.300 0.000
medulloblastoma 1.200 0.004
medulloblastoma, large-cell -1.400 0.001
pediatric high grade glioma -1.100 0.000
non primary Sjogren syndrome sicca -1.200 0.025

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
879 confirmatory 12 / 20 / 1247 qHTS Assay for Inhibitors of RGS12 GoLoco Motif Activity (Green Fluorophore)
880 confirmatory 1029 / 0 / 233132 qHTS Assay for Inhibitors of RGS12 GoLoco Motif Activity (Red Fluorophore)
2390 confirmatory 59 / 29 / 24 Confirmation qHTS Assay for Inhibitors of RGS12 GoLoco Motif Activity (Red Fluorophore)
2406 summary 0 / 0 / 0 Probe Development Summary for Inhibitors of RGS12 GoLoco Motif Activity

Gene RIF (5)

PMID Text
20627871 Observational study of gene-disease association. (HuGE Navigator)
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
17042716 RGS12 is essential for the terminal differentiation of osteoclasts induced by RANKL.
9168931 shows chromosomal mapping information for human locus.

AA Sequence

MFRAGEASKRPLPGPSPPRVRSVEVARGRAGYGFTLSGQAPCVLSCVMRGSPADFVGLRAGDQILAVNEI      1 - 70
NVKKASHEDVVKLIGKCSGVLHMVIAEGVGRFESCSSDEEGGLYEGKGWLKPKLDSKALGINRAERVVEE     71 - 140
MQSGGIFNMIFENPSLCASNSEPLKLKQRSLSESAATRFDVGHESINNPNPNMLSKEEISKVIHDDSVFS    141 - 210
IGLESHDDFALDASILNVAMIVGYLGSIELPSTSSNLESDSLQAIRGCMRRLRAEQKIHSLVTMKIMHDC    211 - 280
VQLSTDKAGVVAEYPAEKLAFSAVCPDDRRFFGLVTMQTNDDGSLAQEEEGALRTSCHVFMVDPDLFNHK    281 - 350
IHQGIARRFGFECTADPDTNGCLEFPASSLPVLQFISVLYRDMGELIEGMRARAFLDGDADAHQNNSTSS    351 - 420
NSDSGIGNFHQEEKSNRVLVVDLGGSSSRHGPGGSAWDGVGGRGAQPWGAPWTGPFCPDPEGSPPFEAAH    421 - 490
QTDRFWDLNKHLGPASPVEVPPASLRSSVPPSKRGTVGAGCGFNQRWLPVHVLREWQCGHTSDQDSYTDS    491 - 560
TDGWSSINCGTLPPPMSKIPADRYRVEGSFAQPPLNAPKREWSRKAFGMQSIFGPHRNVRKTKEDKKGSK    561 - 630
FGRGTGLTQPSQRTSARRSFGRSKRFSITRSLDDLESATVSDGELTGADLKDCVSNNSLSSNASLPSVQS    631 - 700
CRRLRERRVASWAVSFERLLQDPVGVRYFSDFLRKEFSEENILFWQACEYFNHVPAHDKKELSYRAREIF    701 - 770
SKFLCSKATTPVNIDSQAQLADDVLRAPHPDMFKEQQLQIFNLMKFDSYTRFLKSPLYQECILAEVEGRA    771 - 840
LPDSQQVPSSPASKHSLGSDHSSVSTPKKLSGKSKSGRSLNEELGDEDSEKKRKGAFFSWSRTRSTGRSQ    841 - 910
KKREHGDHADDALHANGGLCRRESQGSVSSAGSLDLSEACRTLAPEKDKATKHCCIHLPDGTSCVVAVKA    911 - 980
GFSIKDILSGLCERHGINGAAADLFLVGGDKPLVLHQDSSILESRDLRLEKRTLFRLDLVPINRSVGLKA    981 - 1050
KPTKPVTEVLRPVVARYGLDLSGLLVRLSGEKEPLDLGAPISSLDGQRVVLEEKDPSRGKASADKQKGVP   1051 - 1120
VKQNTAVNSSSRNHSATGEERTLGKSNSIKIKGENGKNARDPRLSKREESIAKIGKKKYQKINLDEAEEF   1121 - 1190
FELISKAQSNRADDQRGLLRKEDLVLPEFLRLPPGSTELTLPTPAAVAKGFSKRSATGNGRESASQPGEQ   1191 - 1260
WEPVQESSDSPSTSPGSASSPPGPPGTTPPGQKSPSGPFCTPQSPVSLAQEGTAQIWKRQSQEVEAGGIQ   1261 - 1330
TVEDEHVAELTLMGEGDISSPNSTLLPPPSTPQEVPGPSRPGSGTHGSRDLPVNRIIDVDLVTGSAPGRD   1331 - 1400
GGIAGAQAGPGRSQASGGPPTSDLPGLGPVPGEPAKPKTSAHHATFV                          1401 - 1447
//

Text Mined References (25)

PMID Year Title
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
21822266 2011 Exome sequencing supports a de novo mutational paradigm for schizophrenia.
20627871 2010 Genetic variations in regulator of G-protein signaling genes as susceptibility loci for second primary tumor/recurrence in head and neck squamous cell carcinoma.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
18434541 2008 Structural diversity in the RGS domain and its interaction with heterotrimeric G protein alpha-subunits.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17042716 2007 RGS12 is essential for RANKL-evoked signaling for terminal differentiation of osteoclasts in vitro.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
More...