Property Summary

NCBI Gene PubMed Count 19
PubMed Score 23.54
PubTator Score 14.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Schizophrenia 503
Disease Target Count P-value
posterior fossa group A ependymoma 1511 1.03147003398129E-7
glioblastoma 5572 1.55429510393592E-6
pediatric high grade glioma 2712 2.17369693994209E-5
osteosarcoma 7933 3.09463410462844E-5
psoriasis 6685 2.04583510855649E-4
atypical teratoid / rhabdoid tumor 4369 5.05133034482619E-4
medulloblastoma, large-cell 6234 0.00112373806819758
oligodendroglioma 2849 0.0020298528720832
medulloblastoma 1524 0.00359776178885968
non primary Sjogren syndrome sicca 840 0.0251977678366507
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (10)

Disease log2 FC p
posterior fossa group A ependymoma -1.300 0.000
oligodendroglioma 1.200 0.002
psoriasis 1.800 0.000
osteosarcoma -1.517 0.000
atypical teratoid / rhabdoid tumor -1.200 0.001
glioblastoma -1.300 0.000
medulloblastoma 1.200 0.004
medulloblastoma, large-cell -1.400 0.001
pediatric high grade glioma -1.100 0.000
non primary Sjogren syndrome sicca -1.200 0.025

Gene

PANTHER Protein Class (2)

PDB

2EBZ   2KV8  

  Ortholog (12)

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
879 confirmatory 12 / 20 / 1247 qHTS Assay for Inhibitors of RGS12 GoLoco Motif Activity (Green Fluorophore)
880 confirmatory 1029 / 0 / 233132 qHTS Assay for Inhibitors of RGS12 GoLoco Motif Activity (Red Fluorophore)
2390 confirmatory 59 / 29 / 24 Confirmation qHTS Assay for Inhibitors of RGS12 GoLoco Motif Activity (Red Fluorophore)
2406 summary 0 / 0 / 0 Probe Development Summary for Inhibitors of RGS12 GoLoco Motif Activity

Gene RIF (5)

PMID Text
20627871 Observational study of gene-disease association. (HuGE Navigator)
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
17042716 RGS12 is essential for the terminal differentiation of osteoclasts induced by RANKL.
9168931 shows chromosomal mapping information for human locus.

AA Sequence

MFRAGEASKRPLPGPSPPRVRSVEVARGRAGYGFTLSGQAPCVLSCVMRGSPADFVGLRAGDQILAVNEI      1 - 70
NVKKASHEDVVKLIGKCSGVLHMVIAEGVGRFESCSSDEEGGLYEGKGWLKPKLDSKALGINRAERVVEE     71 - 140
MQSGGIFNMIFENPSLCASNSEPLKLKQRSLSESAATRFDVGHESINNPNPNMLSKEEISKVIHDDSVFS    141 - 210
IGLESHDDFALDASILNVAMIVGYLGSIELPSTSSNLESDSLQAIRGCMRRLRAEQKIHSLVTMKIMHDC    211 - 280
VQLSTDKAGVVAEYPAEKLAFSAVCPDDRRFFGLVTMQTNDDGSLAQEEEGALRTSCHVFMVDPDLFNHK    281 - 350
IHQGIARRFGFECTADPDTNGCLEFPASSLPVLQFISVLYRDMGELIEGMRARAFLDGDADAHQNNSTSS    351 - 420
NSDSGIGNFHQEEKSNRVLVVDLGGSSSRHGPGGSAWDGVGGRGAQPWGAPWTGPFCPDPEGSPPFEAAH    421 - 490
QTDRFWDLNKHLGPASPVEVPPASLRSSVPPSKRGTVGAGCGFNQRWLPVHVLREWQCGHTSDQDSYTDS    491 - 560
TDGWSSINCGTLPPPMSKIPADRYRVEGSFAQPPLNAPKREWSRKAFGMQSIFGPHRNVRKTKEDKKGSK    561 - 630
FGRGTGLTQPSQRTSARRSFGRSKRFSITRSLDDLESATVSDGELTGADLKDCVSNNSLSSNASLPSVQS    631 - 700
CRRLRERRVASWAVSFERLLQDPVGVRYFSDFLRKEFSEENILFWQACEYFNHVPAHDKKELSYRAREIF    701 - 770
SKFLCSKATTPVNIDSQAQLADDVLRAPHPDMFKEQQLQIFNLMKFDSYTRFLKSPLYQECILAEVEGRA    771 - 840
LPDSQQVPSSPASKHSLGSDHSSVSTPKKLSGKSKSGRSLNEELGDEDSEKKRKGAFFSWSRTRSTGRSQ    841 - 910
KKREHGDHADDALHANGGLCRRESQGSVSSAGSLDLSEACRTLAPEKDKATKHCCIHLPDGTSCVVAVKA    911 - 980
GFSIKDILSGLCERHGINGAAADLFLVGGDKPLVLHQDSSILESRDLRLEKRTLFRLDLVPINRSVGLKA    981 - 1050
KPTKPVTEVLRPVVARYGLDLSGLLVRLSGEKEPLDLGAPISSLDGQRVVLEEKDPSRGKASADKQKGVP   1051 - 1120
VKQNTAVNSSSRNHSATGEERTLGKSNSIKIKGENGKNARDPRLSKREESIAKIGKKKYQKINLDEAEEF   1121 - 1190
FELISKAQSNRADDQRGLLRKEDLVLPEFLRLPPGSTELTLPTPAAVAKGFSKRSATGNGRESASQPGEQ   1191 - 1260
WEPVQESSDSPSTSPGSASSPPGPPGTTPPGQKSPSGPFCTPQSPVSLAQEGTAQIWKRQSQEVEAGGIQ   1261 - 1330
TVEDEHVAELTLMGEGDISSPNSTLLPPPSTPQEVPGPSRPGSGTHGSRDLPVNRIIDVDLVTGSAPGRD   1331 - 1400
GGIAGAQAGPGRSQASGGPPTSDLPGLGPVPGEPAKPKTSAHHATFV                          1401 - 1447
//

Text Mined References (25)

PMID Year Title
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
21822266 2011 Exome sequencing supports a de novo mutational paradigm for schizophrenia.
20627871 2010 Genetic variations in regulator of G-protein signaling genes as susceptibility loci for second primary tumor/recurrence in head and neck squamous cell carcinoma.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
18434541 2008 Structural diversity in the RGS domain and its interaction with heterotrimeric G protein alpha-subunits.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17042716 2007 RGS12 is essential for RANKL-evoked signaling for terminal differentiation of osteoclasts in vitro.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
More...