Property Summary

NCBI Gene PubMed Count 13
PubMed Score 6.62
PubTator Score 4.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 4.9483302015796E-29
tuberculosis 1563 1.35824277887634E-7
psoriasis 6685 4.40788621483008E-4
primary Sjogren syndrome 789 7.50900074353638E-4
Atopic dermatitis 944 0.00110960346164722
head and neck cancer 270 0.0289115771577839
nasopharyngeal carcinoma 1056 0.0301911448030512
pancreatic carcinoma 567 0.0470011714121673
pancreatic cancer 2300 0.0470011714121674

Expression

  Differential Expression (9)

Disease log2 FC p
pancreatic cancer 1.400 0.047
psoriasis -1.100 0.000
Atopic dermatitis -1.800 0.001
tuberculosis -3.400 0.000
non-small cell lung cancer -2.690 0.000
primary Sjogren syndrome 2.900 0.001
pancreatic carcinoma 1.400 0.047
nasopharyngeal carcinoma -1.800 0.030
head and neck cancer -1.800 0.029

Synonym

Accession O14921 Q6PGR2 Q8TD63 Q9BX45 RGS13
Symbols

Gene

PANTHER Protein Class (2)

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid

Gene RIF (8)

PMID Text
21531726 p53 may modulate immune responses through suppression of RGS13 transcription in mast cells and B cells
20974683 RGS13 turnover was significantly reduced in cells stimulated with cAMP, which was reversed by expression of the PKA-specific inhibitory peptide PKI.
20627871 Observational study of gene-disease association. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
19017978 RGS13 overexpression inhibited CXCL12-evoked Ca(2+) mobilization, Akt phosphorylation and chemotaxis.
16565322 RGS1 and RGS13 act together to regulate chemokine receptor signaling in human germinal center B lymphocytes and contribute significantly to the rapid desensitization of the signaling pathway.
12970790 Down-Regulation of regulator of G-protein signalling 13 is associated with mantle cell lymphoma
11875076 Functional characterization of the G protein regulator RGS13

AA Sequence

MSRRNCWICKMCRDESKRPPSNLTLEEVLQWAQSFENLMATKYGPVVYAAYLKMEHSDENIQFWMACETY      1 - 70
KKIASRWSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQKIVYMHMERDSYPRF     71 - 140
LKSEMYQKLLKTMQSNNSF                                                       141 - 159
//

Text Mined References (13)

PMID Year Title
21531726 2011 p53 negatively regulates RGS13 protein expression in immune cells.
20974683 2010 Phosphorylation of RGS13 by the cyclic AMP-dependent protein kinase inhibits RGS13 degradation.
20627871 2010 Genetic variations in regulator of G-protein signaling genes as susceptibility loci for second primary tumor/recurrence in head and neck squamous cell carcinoma.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
19017978 2008 RGS13 controls g protein-coupled receptor-evoked responses of human mast cells.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16565322 2006 RGS1 and RGS13 mRNA silencing in a human B lymphoma line enhances responsiveness to chemoattractants and impairs desensitization.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12970790 2003 High level of cannabinoid receptor 1, absence of regulator of G protein signalling 13 and differential expression of Cyclin D1 in mantle cell lymphoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...