Property Summary

NCBI Gene PubMed Count 13
Grant Count 14
R01 Count 6
Funding $564,777.19
PubMed Score 6.62
PubTator Score 4.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
pancreatic cancer 1.400 0.047
psoriasis -1.100 0.000
Atopic dermatitis -1.800 0.001
tuberculosis -3.400 0.000
non-small cell lung cancer -2.690 0.000
primary Sjogren syndrome 2.900 0.001
pancreatic carcinoma 1.400 0.047
nasopharyngeal carcinoma -1.800 0.030
head and neck cancer -1.800 0.029

Gene RIF (8)

PMID Text
21531726 p53 may modulate immune responses through suppression of RGS13 transcription in mast cells and B cells
20974683 RGS13 turnover was significantly reduced in cells stimulated with cAMP, which was reversed by expression of the PKA-specific inhibitory peptide PKI.
20627871 Observational study of gene-disease association. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
19017978 RGS13 overexpression inhibited CXCL12-evoked Ca(2+) mobilization, Akt phosphorylation and chemotaxis.
16565322 RGS1 and RGS13 act together to regulate chemokine receptor signaling in human germinal center B lymphocytes and contribute significantly to the rapid desensitization of the signaling pathway.
12970790 Down-Regulation of regulator of G-protein signalling 13 is associated with mantle cell lymphoma
11875076 Functional characterization of the G protein regulator RGS13

AA Sequence

MSRRNCWICKMCRDESKRPPSNLTLEEVLQWAQSFENLMATKYGPVVYAAYLKMEHSDENIQFWMACETY      1 - 70
KKIASRWSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQKIVYMHMERDSYPRF     71 - 140
LKSEMYQKLLKTMQSNNSF                                                       141 - 159
//

Text Mined References (13)

PMID Year Title
21531726 2011 p53 negatively regulates RGS13 protein expression in immune cells.
20974683 2010 Phosphorylation of RGS13 by the cyclic AMP-dependent protein kinase inhibits RGS13 degradation.
20627871 2010 Genetic variations in regulator of G-protein signaling genes as susceptibility loci for second primary tumor/recurrence in head and neck squamous cell carcinoma.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
19017978 2008 RGS13 controls g protein-coupled receptor-evoked responses of human mast cells.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16565322 2006 RGS1 and RGS13 mRNA silencing in a human B lymphoma line enhances responsiveness to chemoattractants and impairs desensitization.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12970790 2003 High level of cannabinoid receptor 1, absence of regulator of G protein signalling 13 and differential expression of Cyclin D1 in mantle cell lymphoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...