Property Summary

Ligand Count 208
NCBI Gene PubMed Count 348
PubMed Score 790.14
PubTator Score 491.73

Knowledge Summary

Patent (29,687)

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytoma 1.300 1.1e-28
Astrocytoma, Pilocytic 1.100 2.4e-05
ependymoma 1.200 4.1e-02
Gaucher disease type 1 -1.200 1.4e-02
glioblastoma 1.200 8.6e-03
intraductal papillary-mucinous adenoma (... 1.200 1.3e-02
intraductal papillary-mucinous carcinoma... 1.300 2.7e-02
intraductal papillary-mucinous neoplasm ... 1.400 3.1e-02
oligodendroglioma 1.100 2.5e-02
osteosarcoma -2.295 4.9e-05
ovarian cancer -2.000 2.4e-06
pancreatic ductal adenocarcinoma liver m... 1.087 4.0e-02
psoriasis -1.200 3.8e-02
Waldenstrons macroglobulinemia 1.122 5.4e-03

 OMIM Phenotype (1)

Protein-protein Interaction (2)

Gene RIF (245)

AA Sequence

MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCLEIQIMRRLTH      1 - 70
PNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREGAILTLLSDIASALRYLHENR     71 - 140
IIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCTSFVGTLQYLAPELLEQQKYTVTVDYWSFGT    141 - 210
LAFECITGFRPFLPNWQPVQWHSKVRQKSEVDIVVSEDLNGTVKFSSSLPYPNNLNSVLAERLEKWLQLM    211 - 280
LMWHPRQRGTDPTYGPNGCFKALDDILNLKLVHILNMVTGTIHTYPVTEDESLQSLKARIQQDTGIPEED    281 - 350
QELLQEAGLALIPDKPATQCISDGKLNEGHTLDMDLVFLFDNSKITYETQISPRPQPESVSCILQEPKRN    351 - 420
LAFFQLRKVWGQVWHSIQTLKEDCNRLQQGQRAAMMNLLRNNSCLSKMKNSMASMSQQLKAKLDFFKTSI    421 - 490
QIDLEKYSEQTEFGITSDKLLLAWREMEQAVELCGRENEVKLLVERMMALQTDIVDLQRSPMGRKQGGTL    491 - 560
DDLEEQARELYRRLREKPRDQRTEGDSQEMVRLLLQAIQSFEKKVRVIYTQLSKTVVCKQKALELLPKVE    561 - 630
EVVSLMNEDEKTVVRLQEKRQKELWNLLKIACSKVRGPVSGSPDSMNASRLSQPGQLMSQPSTASNSLPE    631 - 700
PAKKSEELVAEAHNLCTLLENAIQDTVREQDQSFTALDWSWLQTEEEEHSCLEQAS                  701 - 756
//

Text Mined References (373)

PMID Year Title