Property Summary

NCBI Gene PubMed Count 319
Grant Count 432
R01 Count 255
Funding $35,592,491.17
PubMed Score 736.33
PubTator Score 491.73

Knowledge Summary

Patent (29,687)

Expression

Synonym

Accession O14920 B4DZ30 B4E0U4 O75327 I-kappa-B-kinase beta
Symbols IKK2
IKKB
IMD15
NFKBIKB
IKK-beta

Gene

PDB

3BRT   3BRV   4E3C   4KIK  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (229)

PMID Text
26914121 Over-expressed IKK-Beta inhibits cell apoptosis in laryngeal squamous cell carcinoma.
26718331 Survivin overexpression activates NFkappaB p65, which is important in the acquisition and maintenance of the oncogenic characteristics of esophageal squamous cell carcinoma.
26669856 MyD88s is positively regulated by IKKbeta and CREB and negatively regulated by ERK1/2 signaling pathways.
26647777 DAT stabilized IkBa by inhibiting the phosphorylation of Ika by the IkB kinase (IKK) complex. DAT induced proteasomal degradation of TRAF6, and DAT suppressed IKKb-phosphorylation through downregulation of TRAF6
26603838 IKK-beta suppresses GLI1 ubiquitination.
26427514 Down-regulation of IKBKB expression and NFkappaB signaling in microglia/macrophages infiltrating glioblastoma correlates with defective expression of immune/inflammatory genes and M2 polarization that may result in the global impairment of anti-tumor immune responses in glioblastoma.
26334375 IFIT5 promotes SeV-induced IKK phosphorylation and NF-kappaB activation by regulating the recruitment of IKK to TAK1.
26301506 In cells with functional KEAP1, RTA 405 increased NRF2 levels, but not IKKb or BCL2 levels, and did not increase cell proliferation or survival.
26267322 Combining bortezomib with IKK inhibitor is effective in treating ovarian cancer.
26167925 findings indicate that the IKBKB and POLB SNPs confer no genetic predisposition to SLE risk in this Chinese Han population
More...

AA Sequence

MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCLEIQIMRRLTH      1 - 70
PNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREGAILTLLSDIASALRYLHENR     71 - 140
IIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCTSFVGTLQYLAPELLEQQKYTVTVDYWSFGT    141 - 210
LAFECITGFRPFLPNWQPVQWHSKVRQKSEVDIVVSEDLNGTVKFSSSLPYPNNLNSVLAERLEKWLQLM    211 - 280
LMWHPRQRGTDPTYGPNGCFKALDDILNLKLVHILNMVTGTIHTYPVTEDESLQSLKARIQQDTGIPEED    281 - 350
QELLQEAGLALIPDKPATQCISDGKLNEGHTLDMDLVFLFDNSKITYETQISPRPQPESVSCILQEPKRN    351 - 420
LAFFQLRKVWGQVWHSIQTLKEDCNRLQQGQRAAMMNLLRNNSCLSKMKNSMASMSQQLKAKLDFFKTSI    421 - 490
QIDLEKYSEQTEFGITSDKLLLAWREMEQAVELCGRENEVKLLVERMMALQTDIVDLQRSPMGRKQGGTL    491 - 560
DDLEEQARELYRRLREKPRDQRTEGDSQEMVRLLLQAIQSFEKKVRVIYTQLSKTVVCKQKALELLPKVE    561 - 630
EVVSLMNEDEKTVVRLQEKRQKELWNLLKIACSKVRGPVSGSPDSMNASRLSQPGQLMSQPSTASNSLPE    631 - 700
PAKKSEELVAEAHNLCTLLENAIQDTVREQDQSFTALDWSWLQTEEEEHSCLEQAS                  701 - 756
//

Text Mined References (345)

PMID Year Title
26914121 2016 Laryngeal squamous cell carcinoma progression is associated with the NF?B signaling pathway regulated by I?B kinase ?.
26718331 2016 Survivin activates NF??B p65 via the IKK? promoter in esophageal squamous cell carcinoma.
26669856 2015 Nontypeable Haemophilus influenzae-Induced MyD88 Short Expression Is Regulated by Positive IKK? and CREB Pathways and Negative ERK1/2 Pathway.
26647777 2016 Diallyl trisulfide induces apoptosis by suppressing NF-?B signaling through destabilization of TRAF6 in primary effusion lymphoma.
26603838 2016 Active IKK? promotes the stability of GLI1 oncogene in diffuse large B-cell lymphoma.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26427514 2015 Down-regulation of IKK? expression in glioma-infiltrating microglia/macrophages is associated with defective inflammatory/immune gene responses in glioblastoma.
26334375 2015 IFIT5 positively regulates NF-?B signaling through synergizing the recruitment of I?B kinase (IKK) to TGF-?-activated kinase 1 (TAK1).
26301506 2015 Cancer Cell Growth Is Differentially Affected by Constitutive Activation of NRF2 by KEAP1 Deletion and Pharmacological Activation of NRF2 by the Synthetic Triterpenoid, RTA 405.
26267322 2015 IKK inhibition increases bortezomib effectiveness in ovarian cancer.
More...