Property Summary

NCBI Gene PubMed Count 30
Grant Count 8
R01 Count 5
Funding $469,074.17
PubMed Score 20.44
PubTator Score 20.07

Knowledge Summary

Patent

No data available

Expression

Gene RIF (12)

PMID Text
26700620 DNA methylation in a combination of POU4F2/PCDH17 has yielded the highest sensitivity and specificity of 90.00% and 93.96% in all the 312 individuals, showing the capability of detecting bladder cancer effectively among pathologically varied sample groups.
26683656 PCDH17 methylation in serum is a frequent event in early-stage prostate cancer, and it is an independent predictor of BCR after radical prostatectomy
26404644 PCDH17 methylation occurred more frequently and was associated with malignant clinicopathological characteristics and poor prognosis in clear cell renal cell carcinoma patients
24567353 PCDH17 promoter methylation is closely associated with bladder cancer malignancy and may be used as an independent predictor of clinical outcomes in patients with bladder cancer.
24366498 PCDH17 promoter methylation was significantly associated with malignant behaviour and poor prognosis of bladder cancer
23684785 This study demonistrated that critical role for PCDH17 in the synaptic development of specific corticobasal ganglia circuits and suggest the involvement of PCDH17 in such circuits in depressive behaviors.
22926751 PCDH17 acts as a tumour suppressor, exerting its anti-proliferative activity through inducing apoptosis and autophagy, and is frequently silenced in gastric and colorectal cancers.
22207556 Our study clearly demonstrates that PCDH17 is transcriptionally downregulated in gastric cancer due to aberrant promoter CpG island methylation
21213369 statistical significant downregulation of PCDH17/PCH68 and PTPRD was observed
20200074 results suggest that silencing of PCDH17 expression through hypermethylation of the promoter or other mechanisms leads to loss of its tumour-suppressive activity, which may be a factor in the carcinogenesis of a subgroup of ESCCs
More...

AA Sequence

MYLSICCCFLLWAPALTLKNLNYSVPEEQGAGTVIGNIGRDARLQPGLPPAERGGGGRSKSGSYRVLENS      1 - 70
APHLLDVDADSGLLYTKQRIDRESLCRHNAKCQLSLEVFANDKEICMIKVEIQDINDNAPSFSSDQIEMD     71 - 140
ISENAAPGTRFPLTSAHDPDAGENGLRTYLLTRDDHGLFGLDVKSRGDGTKFPELVIQKALDREQQNHHT    141 - 210
LVLTALDGGEPPRSATVQINVKVIDSNDNSPVFEAPSYLVELPENAPLGTVVIDLNATDADEGPNGEVLY    211 - 280
SFSSYVPDRVRELFSIDPKTGLIRVKGNLDYEENGMLEIDVQARDLGPNPIPAHCKVTVKLIDRNDNAPS    281 - 350
IGFVSVRQGALSEAAPPGTVIALVRVTDRDSGKNGQLQCRVLGGGGTGGGGGLGGPGGSVPFKLEENYDN    351 - 420
FYTVVTDRPLDRETQDEYNVTIVARDGGSPPLNSTKSFAIKILDENDNPPRFTKGLYVLQVHENNIPGEY    421 - 490
LGSVLAQDPDLGQNGTVSYSILPSHIGDVSIYTYVSVNPTNGAIYALRSFNFEQTKAFEFKVLAKDSGAP    491 - 560
AHLESNATVRVTVLDVNDNAPVIVLPTLQNDTAELQVPRNAGLGYLVSTVRALDSDFGESGRLTYEIVDG    561 - 630
NDDHLFEIDPSSGEIRTLHPFWEDVTPVVELVVKVTDHGKPTLSAVAKLIIRSVSGSLPEGVPRVNGEQH    631 - 700
HWDMSLPLIVTLSTISIILLAAMITIAVKCKRENKEIRTYNCRIAEYSHPQLGGGKGKKKKINKNDIMLV    701 - 770
QSEVEERNAMNVMNVVSSPSLATSPMYFDYQTRLPLSSPRSEVMYLKPASNNLTVPQGHAGCHTSFTGQG    771 - 840
TNASETPATRMSIIQTDNFPAEPNYMGSRQQFVQSSSTFKDPERASLRDSGHGDSDQADSDQDTNKGSCC    841 - 910
DMSVREALKMKTTSTKSQPLEQEPEECVNCTDECRVLGHSDRCWMPQFPAANQAENADYRTNLFVPTVEA    911 - 980
NVETETYETVNPTGKKTFCTFGKDKREHTILIANVKPYLKAKRALSPLLQEVPSASSSPTKACIEPCTST    981 - 1050
KGSLDGCEAKPGALAEASSQYLPTDSQYLSPSKQPRDPPFMASDQMARVFADVHSRASRDSSEMGAVLEQ   1051 - 1120
LDHPNRDLGRESVDAEEVVREIDKLLQDCRGNDPVAVRK                                  1121 - 1159
//

Text Mined References (30)

PMID Year Title
26700620 2016 An epigenetic biomarker combination of PCDH17 and POU4F2 detects bladder cancer accurately by methylation analyses of urine sediment DNA in Han Chinese.
26683656 2015 Aberrant Protocadherin17 (PCDH17) Methylation in Serum is a Potential Predictor for Recurrence of Early-Stage Prostate Cancer Patients After Radical Prostatectomy.
26404644 2015 Protocadherin17 Promoter Methylation is a Potential Predictive Biomarker in Clear Cell Renal Cell Carcinoma.
24567353 2014 Protocadherin 17 promoter methylation in tumour tissue from patients with bladder transitional cell carcinoma.
24366498 2014 Protocadherin-17 promoter methylation in serum-derived DNA is associated with poor prognosis of bladder cancer.
23684785 2013 Protocadherin 17 regulates presynaptic assembly in topographic corticobasal Ganglia circuits.
22926751 2013 Protocadherin 17 acts as a tumour suppressor inducing tumour cell apoptosis and autophagy, and is frequently methylated in gastric and colorectal cancers.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22207556 2012 PCDH17 gene promoter demethylation and cell cycle arrest by genistein in gastric cancer.
21213369 2011 High resolution ArrayCGH and expression profiling identifies PTPRD and PCDH17/PCH68 as tumor suppressor gene candidates in laryngeal squamous cell carcinoma.
More...