Property Summary

NCBI Gene PubMed Count 32
PubMed Score 21.59
PubTator Score 20.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
lung cancer -1.300 7.2e-04
astrocytoma 1.300 3.9e-02
atypical teratoid / rhabdoid tumor -1.600 2.9e-02
Breast cancer 2.700 3.0e-02
ependymoma -2.400 1.1e-08
group 4 medulloblastoma -1.500 2.2e-02
interstitial cystitis 1.900 4.9e-02
intraductal papillary-mucinous adenoma (... -2.300 5.2e-05
intraductal papillary-mucinous carcinoma... -2.700 4.7e-05
intraductal papillary-mucinous neoplasm ... -2.700 3.1e-04
juvenile dermatomyositis 1.280 2.7e-11
lung adenocarcinoma -1.200 1.0e-11
lung carcinoma -1.500 1.4e-09
medulloblastoma, large-cell -1.500 4.4e-02
non-small cell lung cancer -1.185 3.4e-08
osteosarcoma 1.123 2.4e-02
ovarian cancer -2.700 2.1e-10
pancreatic ductal adenocarcinoma liver m... 1.031 9.2e-03
periodontitis 1.100 3.4e-25
ulcerative colitis 1.500 7.3e-05
urothelial carcinoma 1.100 3.6e-02

Gene RIF (14)

AA Sequence

MYLSICCCFLLWAPALTLKNLNYSVPEEQGAGTVIGNIGRDARLQPGLPPAERGGGGRSKSGSYRVLENS      1 - 70
APHLLDVDADSGLLYTKQRIDRESLCRHNAKCQLSLEVFANDKEICMIKVEIQDINDNAPSFSSDQIEMD     71 - 140
ISENAAPGTRFPLTSAHDPDAGENGLRTYLLTRDDHGLFGLDVKSRGDGTKFPELVIQKALDREQQNHHT    141 - 210
LVLTALDGGEPPRSATVQINVKVIDSNDNSPVFEAPSYLVELPENAPLGTVVIDLNATDADEGPNGEVLY    211 - 280
SFSSYVPDRVRELFSIDPKTGLIRVKGNLDYEENGMLEIDVQARDLGPNPIPAHCKVTVKLIDRNDNAPS    281 - 350
IGFVSVRQGALSEAAPPGTVIALVRVTDRDSGKNGQLQCRVLGGGGTGGGGGLGGPGGSVPFKLEENYDN    351 - 420
FYTVVTDRPLDRETQDEYNVTIVARDGGSPPLNSTKSFAIKILDENDNPPRFTKGLYVLQVHENNIPGEY    421 - 490
LGSVLAQDPDLGQNGTVSYSILPSHIGDVSIYTYVSVNPTNGAIYALRSFNFEQTKAFEFKVLAKDSGAP    491 - 560
AHLESNATVRVTVLDVNDNAPVIVLPTLQNDTAELQVPRNAGLGYLVSTVRALDSDFGESGRLTYEIVDG    561 - 630
NDDHLFEIDPSSGEIRTLHPFWEDVTPVVELVVKVTDHGKPTLSAVAKLIIRSVSGSLPEGVPRVNGEQH    631 - 700
HWDMSLPLIVTLSTISIILLAAMITIAVKCKRENKEIRTYNCRIAEYSHPQLGGGKGKKKKINKNDIMLV    701 - 770
QSEVEERNAMNVMNVVSSPSLATSPMYFDYQTRLPLSSPRSEVMYLKPASNNLTVPQGHAGCHTSFTGQG    771 - 840
TNASETPATRMSIIQTDNFPAEPNYMGSRQQFVQSSSTFKDPERASLRDSGHGDSDQADSDQDTNKGSCC    841 - 910
DMSVREALKMKTTSTKSQPLEQEPEECVNCTDECRVLGHSDRCWMPQFPAANQAENADYRTNLFVPTVEA    911 - 980
NVETETYETVNPTGKKTFCTFGKDKREHTILIANVKPYLKAKRALSPLLQEVPSASSSPTKACIEPCTST    981 - 1050
KGSLDGCEAKPGALAEASSQYLPTDSQYLSPSKQPRDPPFMASDQMARVFADVHSRASRDSSEMGAVLEQ   1051 - 1120
LDHPNRDLGRESVDAEEVVREIDKLLQDCRGNDPVAVRK                                  1121 - 1159
//

Text Mined References (32)

PMID Year Title