Property Summary

NCBI Gene PubMed Count 26
PubMed Score 51.15
PubTator Score 25.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung adenocarcinoma 2714 7.90582009613384E-24
non-small cell lung cancer 2798 2.430224456973E-20
lung carcinoma 2844 4.90242905597054E-20
ovarian cancer 8492 2.4324832934779E-14
atypical teratoid / rhabdoid tumor 4369 1.64077758848493E-6
group 4 medulloblastoma 1875 1.79179691400559E-6
cystic fibrosis 1670 4.69369953715385E-6
lung cancer 4473 4.77609580171182E-6
pituitary cancer 1972 7.70035926015526E-6
medulloblastoma, large-cell 6234 4.03420105638104E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 1.3807958063436E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 1.4398237854698E-4
malignant mesothelioma 3163 1.8233549895414E-4
osteosarcoma 7933 2.0350996903407E-4
ependymoma 2514 3.30216999101061E-4
glioblastoma 5572 0.00115896874228474
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00133186821336437
pediatric high grade glioma 2712 0.00147345608014039
pilocytic astrocytoma 3086 0.00154380237466559
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00188819437746892
active ulcerative colitis 477 0.00276728722475633
active Crohn's disease 918 0.00346256497365139
Breast cancer 3099 0.00676093193531938
pancreatic cancer 2300 0.0135510850759567
pancreatic carcinoma 567 0.0135510850759567
non primary Sjogren syndrome sicca 840 0.0186637183709557
colon cancer 1475 0.0308970121792287
astrocytic glioma 2241 0.0321847973916218
primitive neuroectodermal tumor 3031 0.0452731177108427
Disease Target Count Z-score Confidence
Pulmonary aspergilloma 4 4.01 2.0
Chronic cervicitis 1 3.088 1.5

Expression

Synonym

Accession O14910 A4FTY3 Q147W1 Q6LES3 Q7LDS4 Lin-7A
Symbols LIN7
VELI1
LIN-7A
MALS-1
TIP-33

Gene

PANTHER Protein Class (1)

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Platypus EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid

 GO Function (1)

Gene RIF (6)

PMID Text
26887652 This study therefore shows that LIN7A has a crucial role in the polarity abnormalities associated with breast carcinogenesis.
24658322 LIN7A depletion disrupts cerebral cortex development, contributing to intellectual disability in 12q21-deletion syndrome.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18286632 Allelic and haplotype association was found between both BDNF and adult ADHD, and LIN-7 and adult ADHD.
17237226 LIN7A is a PDZ protein that interacts with human papillomavirus-16 E6 and forms a tripartite complex with MPP7 and DLG1, regulating the stability and localization of DLG1 to cell junctions.
12110687 coordinated folding and association of the LIN-2, -7 domain

AA Sequence

MLKPSVTSAPTADMATLTVVQPLTLDRDVARAIELLEKLQESGEVPVHKLQSLKKVLQSEFCTAIREVYQ      1 - 70
YMHETITVNGCPEFRARATAKATVAAFAASEGHSHPRVVELPKTDEGLGFNVMGGKEQNSPIYISRIIPG     71 - 140
GVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDSVKLVVRYTPKVLEEMEARFEKLRTARRRQ    141 - 210
QQQLLIQQQQQQQQQQTQQNHMS                                                   211 - 233
//

Text Mined References (28)

PMID Year Title
26887652 2016 LIN7A is a major determinant of cell-polarity defects in breast carcinomas.
25416956 2014 A proteome-scale map of the human interactome network.
25352737 2014 Electronic medical records and genomics (eMERGE) network exploration in cataract: several new potential susceptibility loci.
24658322 2014 LIN7A depletion disrupts cerebral cortex development, contributing to intellectual disability in 12q21-deletion syndrome.
24366813 2013 Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1.
23259602 2012 Genome-wide association scan of dental caries in the permanent dentition.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18286632 2008 Association study of brain-derived neurotrophic factor (BDNF) and LIN-7 homolog (LIN-7) genes with adult attention-deficit/hyperactivity disorder.
17237226 2007 The stardust family protein MPP7 forms a tripartite complex with LIN7 and DLG1 that regulates the stability and localization of DLG1 to cell junctions.
More...