Property Summary

NCBI Gene PubMed Count 27
PubMed Score 53.46
PubTator Score 25.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (29)

Disease log2 FC p
active Crohn's disease -1.324 2.0e-03
active ulcerative colitis -1.698 2.8e-03
adult high grade glioma -1.900 2.9e-03
astrocytic glioma -1.800 3.2e-02
Astrocytoma, Pilocytic -1.300 1.5e-03
atypical teratoid / rhabdoid tumor -1.300 3.7e-04
Breast cancer -1.300 6.8e-03
colon cancer -1.400 3.1e-02
cystic fibrosis 1.750 4.7e-06
ependymoma -1.400 3.3e-04
glioblastoma -1.900 1.6e-04
group 3 medulloblastoma -1.900 2.8e-02
intraductal papillary-mucinous adenoma (... -2.100 1.4e-04
intraductal papillary-mucinous carcinoma... -2.100 1.4e-04
intraductal papillary-mucinous neoplasm ... -2.200 1.9e-03
lung adenocarcinoma -2.100 7.9e-19
lung cancer 2.800 4.8e-06
lung carcinoma -1.900 4.9e-20
malignant mesothelioma -1.500 1.8e-04
medulloblastoma, large-cell -1.200 1.4e-03
non primary Sjogren syndrome sicca -1.200 1.9e-02
non-small cell lung cancer -1.994 2.4e-20
osteosarcoma -2.921 8.9e-06
ovarian cancer -1.900 2.4e-14
pancreatic cancer 1.100 1.4e-02
pancreatic carcinoma 1.100 1.4e-02
pancreatic ductal adenocarcinoma liver m... -1.880 1.3e-03
pituitary cancer -1.400 2.5e-06
primitive neuroectodermal tumor -1.200 4.5e-02

 GO Function (1)

Gene RIF (7)

AA Sequence

MLKPSVTSAPTADMATLTVVQPLTLDRDVARAIELLEKLQESGEVPVHKLQSLKKVLQSEFCTAIREVYQ      1 - 70
YMHETITVNGCPEFRARATAKATVAAFAASEGHSHPRVVELPKTDEGLGFNVMGGKEQNSPIYISRIIPG     71 - 140
GVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDSVKLVVRYTPKVLEEMEARFEKLRTARRRQ    141 - 210
QQQLLIQQQQQQQQQQTQQNHMS                                                   211 - 233
//

Text Mined References (29)

PMID Year Title