Property Summary

NCBI Gene PubMed Count 26
Grant Count 25
R01 Count 22
Funding $1,108,469.19
PubMed Score 51.15
PubTator Score 25.23

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

Gene RIF (6)

PMID Text
26887652 This study therefore shows that LIN7A has a crucial role in the polarity abnormalities associated with breast carcinogenesis.
24658322 LIN7A depletion disrupts cerebral cortex development, contributing to intellectual disability in 12q21-deletion syndrome.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18286632 Allelic and haplotype association was found between both BDNF and adult ADHD, and LIN-7 and adult ADHD.
17237226 LIN7A is a PDZ protein that interacts with human papillomavirus-16 E6 and forms a tripartite complex with MPP7 and DLG1, regulating the stability and localization of DLG1 to cell junctions.
12110687 coordinated folding and association of the LIN-2, -7 domain

AA Sequence

MLKPSVTSAPTADMATLTVVQPLTLDRDVARAIELLEKLQESGEVPVHKLQSLKKVLQSEFCTAIREVYQ      1 - 70
YMHETITVNGCPEFRARATAKATVAAFAASEGHSHPRVVELPKTDEGLGFNVMGGKEQNSPIYISRIIPG     71 - 140
GVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDSVKLVVRYTPKVLEEMEARFEKLRTARRRQ    141 - 210
QQQLLIQQQQQQQQQQTQQNHMS                                                   211 - 233
//

Text Mined References (28)

PMID Year Title
26887652 2016 LIN7A is a major determinant of cell-polarity defects in breast carcinomas.
25416956 2014 A proteome-scale map of the human interactome network.
25352737 2014 Electronic medical records and genomics (eMERGE) network exploration in cataract: several new potential susceptibility loci.
24658322 2014 LIN7A depletion disrupts cerebral cortex development, contributing to intellectual disability in 12q21-deletion syndrome.
24366813 2013 Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1.
23259602 2012 Genome-wide association scan of dental caries in the permanent dentition.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18286632 2008 Association study of brain-derived neurotrophic factor (BDNF) and LIN-7 homolog (LIN-7) genes with adult attention-deficit/hyperactivity disorder.
17237226 2007 The stardust family protein MPP7 forms a tripartite complex with LIN7 and DLG1 that regulates the stability and localization of DLG1 to cell junctions.
More...