Property Summary

NCBI Gene PubMed Count 64
Grant Count 101
R01 Count 90
Funding $8,200,324.74
PubMed Score 120.85
PubTator Score 99.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Cholesterol embolism 5 3.3 1.7

Expression

Synonym

Accession O14908 A8K4I3 A8MZG3 Q9BTC9
Symbols NIP
GIPC
IIP-1
TIP-2
SEMCAP
C19orf3
Hs.6454
GLUT1CBP
RGS19IP1
SYNECTIN
SYNECTIIN

Gene

PANTHER Protein Class (2)

Gene RIF (31)

PMID Text
26787837 Drd3 palmitoylation acts as a molecular switch for Drd3-biased signaling via a GIPC1-dependent route, which is likely to affect the mode of action of antipsychotic drugs.
26757732 The composite biomarker, CAPG and GIPC1 in primary breast tumors, predicted disease outcomes and benefit from zoledronate and may facilitate patient selection for adjuvant bisphosphonate treatment.
25469510 GIPC status determines the loading of cellular cargo in the exosome in pancreatic cancer cells.
23145131 GIPC binds LPA(1) and promotes its trafficking from APPL-containing signaling endosomes to EEA1 early endosomes and thus attenuates LPA-mediated Akt signaling from APPL endosomes.
23128896 Our results do not show a predictive or prognostic function of GIPC1/Synectin expression for the outcome of radiotherapy in prostate cancer.
22593212 a novel non-Smad function for endoglin and GIPC in regulating endothelial cell function during angiogenesis
22082268 The placental lectins reduced the binding of IGF-I to IGF-1 receptor in a dose-dependent manner.
21432940 Knockdown of ADRM1 in amplified ovarian cell-line OAW42 results in downregulation of growth factor GIPC1 and upregulation of tumor-suppressor RECK RNA and protein
21291857 interactions between TRP1-GIPC and GIPC-APPL-AKT provide a potential link between melanogenesis and PI3 kinase signaling
21247498 aim was to evaluate associations with albuminuria of six GLUT1 single nucleotide polymorphisms(SNPs), particularly XbaI and the previously associated Enhancer-2 (Enh2) SNP
More...

AA Sequence

MPLGLGRRKKAPPLVENEEAEPGRGGLGVGEPGPLGGGGSGGPQMGLPPPPPALRPRLVFHTQLAHGSPT      1 - 70
GRIEGFTNVKELYGKIAEAFRLPTAEVMFCTLNTHKVDMDKLLGGQIGLEDFIFAHVKGQRKEVEVFKSE     71 - 140
DALGLTITDNGAGYAFIKRIKEGSVIDHIHLISVGDMIEAINGQSLLGCRHYEVARLLKELPRGRTFTLK    141 - 210
LTEPRKAFDMISQRSAGGRPGSGPQLGTGRGTLRLRSRGPATVEDLPSAFEEKAIEKVDDLLESYMGIRD    211 - 280
TELAATMVELGKDKRNPDELAEALDERLGDFAFPDEFVFDVWGAIGDAKVGRY                     281 - 333
//

Text Mined References (69)

PMID Year Title
26787837 2016 A GIPC1-Palmitate Switch Modulates Dopamine Drd3 Receptor Trafficking and Signaling.
26757732 2016 CAPG and GIPC1: Breast Cancer Biomarkers for Bone Metastasis Development and Treatment.
25469510 2014 GAIP interacting protein C-terminus regulates autophagy and exosome biogenesis of pancreatic cancer through metabolic pathways.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23145131 2012 The PDZ protein GIPC regulates trafficking of the LPA1 receptor from APPL signaling endosomes and attenuates the cell's response to LPA.
23128896 2012 Impact of the adaptor protein GIPC1/Synectin on radioresistance and survival after irradiation of prostate cancer.
22888021 2012 G protein-coupled receptors participate in cytokinesis.
More...