Property Summary

NCBI Gene PubMed Count 65
PubMed Score 127.76
PubTator Score 99.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Cholesterol embolism 5 3.27 1.6

Expression

Synonym

Accession O14908 A8K4I3 A8MZG3 Q9BTC9
Symbols NIP
GIPC
IIP-1
TIP-2
SEMCAP
C19orf3
Hs.6454
GLUT1CBP
RGS19IP1
SYNECTIN
SYNECTIIN

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (32)

AA Sequence

MPLGLGRRKKAPPLVENEEAEPGRGGLGVGEPGPLGGGGSGGPQMGLPPPPPALRPRLVFHTQLAHGSPT      1 - 70
GRIEGFTNVKELYGKIAEAFRLPTAEVMFCTLNTHKVDMDKLLGGQIGLEDFIFAHVKGQRKEVEVFKSE     71 - 140
DALGLTITDNGAGYAFIKRIKEGSVIDHIHLISVGDMIEAINGQSLLGCRHYEVARLLKELPRGRTFTLK    141 - 210
LTEPRKAFDMISQRSAGGRPGSGPQLGTGRGTLRLRSRGPATVEDLPSAFEEKAIEKVDDLLESYMGIRD    211 - 280
TELAATMVELGKDKRNPDELAEALDERLGDFAFPDEFVFDVWGAIGDAKVGRY                     281 - 333
//

Text Mined References (70)

PMID Year Title