Property Summary

NCBI Gene PubMed Count 27
Grant Count 18
R01 Count 10
Funding $2,741,930.9
PubMed Score 48.68
PubTator Score 40.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

 GO Function (1)

Gene RIF (13)

PMID Text
25645515 Mutations in TAX1BP3 cause dilated cardiomyopathy with septo-optic dysplasia
23563176 ARHGEF7, a guanine nucleotide exchange factor for Rho GTPases, as one novel TIP-1-interacting protein in human glioblastoma cells
23395680 this study reports the identification of two new hGIP-interacting partners, DTX1 and STAU1.
23028987 The study provided the first evidence showing that TIP-1 modulates p53 protein stability and is involved in the radioresistance of malignant gliomas.
22876914 The study reports the identification of 18 new glutaminase-interacting protein - binding peptides with novel internal motifs that map to a number of candidate human glutaminase-interacting protein partner proteins.
22564736 this study revealed a novel oncogenic function of TIP-1 suggesting that TIP-1 holds potential as a prognostic biomarker and a therapeutic target in the treatment of human invasive breast cancers.
21787750 This is the first study reporting BAI2 as an interaction partner of GIP.
21139582 HPV16 E6, Tip-1 and ARHGEF16 may cooperate to activate Cdc42 and support a potential link between the expression of HPV16 E6 and Cdc42 activation.
19635485 TIP-1 may act as an important regulator for the endocytic pathway of Kir2.3.
18690705 the overexpression, efficient refolding, single-step purification, and biophysical characterization of recombinant human TIP-1 with three different C-terminal target protein recognition sequence motifs by CD, fluorescence, and NMR methods
More...

AA Sequence

MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAG      1 - 70
LQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS                     71 - 124
//

Text Mined References (35)

PMID Year Title
25645515 2015 Mutations in TAX1BP3 cause dilated cardiomyopathy with septo-optic dysplasia.
25416956 2014 A proteome-scale map of the human interactome network.
23563176 2014 Tax-interacting protein 1 coordinates the spatiotemporal activation of Rho GTPases and regulates the infiltrative growth of human glioblastoma.
23395680 2013 New partner proteins containing novel internal recognition motif for human glutaminase interacting protein (hGIP).
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23028987 2012 Expression of TIP-1 confers radioresistance of malignant glioma cells.
22876914 2012 Specificity and promiscuity in human glutaminase interacting protein recognition: insight from the binding of the internal and C-terminal motif.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22564736 2012 The PDZ protein TIP-1 facilitates cell migration and pulmonary metastasis of human invasive breast cancer cells in athymic mice.
More...