Property Summary

NCBI Gene PubMed Count 27
PubMed Score 52.76
PubTator Score 40.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count Z-score Confidence
Cholesterol embolism 5 3.734 1.9

Expression

Gene RIF (13)

AA Sequence

MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAG      1 - 70
LQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS                     71 - 124
//

Text Mined References (35)

PMID Year Title