Property Summary

NCBI Gene PubMed Count 25
PubMed Score 26.63
PubTator Score 15.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
interstitial cystitis 2312 1.1e-03
chronic rhinosinusitis 512 2.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Motor neuron disease 49 0.0 3.0

Expression

  Differential Expression (2)

Disease log2 FC p
chronic rhinosinusitis -1.065 2.0e-02
interstitial cystitis -1.100 1.1e-03

Protein-protein Interaction (1)

Gene RIF (14)

AA Sequence

MLDGSPLARWLAAAFGLTLLLAALRPSAAYFGLTGSEPLTILPLTLEPEAAAQAHYKACDRLKLERKQRR      1 - 70
MCRRDPGVAETLVEAVSMSALECQFQFRFERWNCTLEGRYRASLLKRGFKETAFLYAISSAGLTHALAKA     71 - 140
CSAGRMERCTCDEAPDLENREAWQWGGCGDNLKYSSKFVKEFLGRRSSKDLRARVDFHNNLVGVKVIKAG    141 - 210
VETTCKCHGVSGSCTVRTCWRQLAPFHEVGKHLKHKYETALKVGSTTNEAAGEAGAISPPRGRASGAGGS    211 - 280
DPLPRTPELVHLDDSPSFCLAGRFSPGTAGRRCHREKNCESICCGRGHNTQSRVVTRPCQCQVRWCCYVE    281 - 350
CRQCTQREEVYTCKG                                                           351 - 365
//

Text Mined References (25)

PMID Year Title