Property Summary

NCBI Gene PubMed Count 23
Grant Count 19
R01 Count 10
Funding $1,436,944.58
PubMed Score 24.18
PubTator Score 15.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
interstitial cystitis -1.100 0.001
chronic rhinosinusitis -1.065 0.020

 GO Function (1)

Gene RIF (13)

PMID Text
27117272 Inhibition of WNT signaling by the PORCN inhibitor WNT974 reduced metastatic spread of UM-SCC cells, especially in UM-SCCs with Notch1 deficiency.
26174360 expression is enhanced in idiopathic carpal tunnel syndrome
25511584 Silencing Wnt9A increased the expression of CHST11 in the colonic epithelial cells, and chromatin immunoprecipitation assay demonstrated enhancing effects of Wnt9A siRNA and exogenous BMP4 on the CHST11 promoter
24778176 These studies reveal how carrageenan exposure can lead to transcriptional events in colonic epithelial cells through decline in arylsulfatase B activity, with subsequent impact on C4S, galectin-3, Sp1, and Wnt9A
23154410 Transgenic wnt9a is required for palatal extension wherein the chondrocytes form a proliferative front, undergo morphological change and intercalate to form the ethmoid plate.
20854080 Using DirectDNA sequencing analysis, we detected ATBF1, CYLD, PARK2 and WNT9A mutations in stomach and colorectal cancers
20613673 Observational study of gene-disease association. (HuGE Navigator)
19863181 Results demonstrated significant up-regulation of WNT-3, WNT-4, WNT-5B, WNT-7B, WNT-9A, WNT-10A, and WNT-16B in patients with CLL compared to normal subjects.
19453261 Observational study of gene-disease association. (HuGE Navigator)
17429723 cDNA gene expression array of Wnt signaling pathway target genes demonstrated significant changes, including 4.5-fold induction of Wnt 9A and suppression of Dickkopf 3 and RHOU genes.
More...

AA Sequence

MLDGSPLARWLAAAFGLTLLLAALRPSAAYFGLTGSEPLTILPLTLEPEAAAQAHYKACDRLKLERKQRR      1 - 70
MCRRDPGVAETLVEAVSMSALECQFQFRFERWNCTLEGRYRASLLKRGFKETAFLYAISSAGLTHALAKA     71 - 140
CSAGRMERCTCDEAPDLENREAWQWGGCGDNLKYSSKFVKEFLGRRSSKDLRARVDFHNNLVGVKVIKAG    141 - 210
VETTCKCHGVSGSCTVRTCWRQLAPFHEVGKHLKHKYETALKVGSTTNEAAGEAGAISPPRGRASGAGGS    211 - 280
DPLPRTPELVHLDDSPSFCLAGRFSPGTAGRRCHREKNCESICCGRGHNTQSRVVTRPCQCQVRWCCYVE    281 - 350
CRQCTQREEVYTCKG                                                           351 - 365
//

Text Mined References (23)

PMID Year Title
27117272 2016 In vivo Wnt pathway inhibition of human squamous cell carcinoma growth and metastasis in the chick chorioallantoic model.
26174360 2015 Enhanced expression of Wnt9a in the flexor tenosynovium in idiopathic carpal tunnel syndrome.
25511584 2015 Regulation of chondroitin-4-sulfotransferase (CHST11) expression by opposing effects of arylsulfatase B on BMP4 and Wnt9A.
24778176 2014 Increased expression of colonic Wnt9A through Sp1-mediated transcriptional effects involving arylsulfatase B, chondroitin 4-sulfate, and galectin-3.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23154410 2013 Distinct requirements for wnt9a and irf6 in extension and integration mechanisms during zebrafish palate morphogenesis.
20854080 2010 Frameshift mutations of ATBF1, WNT9A, CYLD and PARK2 in gastric and colorectal carcinomas with high microsatellite instability.
20613673 Association between polymorphisms in Wnt signaling pathway genes and bone mineral density in postmenopausal Korean women.
19863181 2009 Variation in WNT genes expression in different subtypes of chronic lymphocytic leukemia.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
More...