Property Summary

NCBI Gene PubMed Count 49
Grant Count 48
R01 Count 31
Funding $6,493,047.69
PubMed Score 43.35
PubTator Score 44.70

Knowledge Summary

Patent

No data available

Expression

Gene RIF (41)

PMID Text
25931269 The data suggest a relationship between promoter DNA methylation and KLF11 gene expression in ovarian cancer tumorigenesis.
25504365 identified an evolutionarily conserved metabolic regulator, Kruppel-like factor 11 (KLF11), as a novel browning transcription factor in human adipocytes that is required for rosiglitazone-induced browning.
25502632 Results suggest a role for KLF11 in upregulating MAO-A in depressive disorder and chronic social stress, suggesting that inhibition of the pathways regulated by this transcription factor may aid in the therapeutics of neuropsychiatric illnesses
25076120 KLF11 repressed most endometrial CYP enzymes
24885560 KLF11 regulates distinct gene networks.
24069400 KLF11 is a critical transcription factor in the function of mesenchymal cells and, specifically, as a negative regulator of collagen secretion.
24060634 KLF111 represses glycodelin-A levels and influences its role in the ovarian endometrium.
23915421 Levels of KLF11 are significantly increased in the postmortem prefrontal cortex of subjects with alcohol dependence compared to controls.
23589285 The A347S mutation disrupted KLF11-mediated increases in basal insulin levels and promoter activity and blunted glucose-stimulated insulin secretion.
23555910 Data identify a novel pathogenic role for KLF11 in preventing de novo disease-associated fibrosis in endometriosis.
More...

AA Sequence

MHTPDFAGPDDARAVDIMDICESILERKRHDSERSTCSILEQTDMEAVEALVCMSSWGQRSQKGDLLRIR      1 - 70
PLTPVSDSGDVTTTVHMDAATPELPKDFHSLSTLCITPPQSPDLVEPSTRTPVSPQVTDSKACTATDVLQ     71 - 140
SSAVVARALSGGAERGLLGLEPVPSSPCRAKGTSVIRHTGESPAACFPTIQTPDCRLSDSREGEEQLLGH    141 - 210
FETLQDTHLTDSLLSTNLVSCQPCLHKSGGLLLTDKGQQAGWPGAVQTCSPKNYENDLPRKTTPLISVSV    211 - 280
PAPPVLCQMIPVTGQSSMLPAFLKPPPQLSVGTVRPILAQAAPAPQPVFVGPAVPQGAVMLVLPQGALPP    281 - 350
PAPCAANVMAAGNTKLLPLAPAPVFITSSQNCVPQVDFSRRRNYVCSFPGCRKTYFKSSHLKAHLRTHTG    351 - 420
EKPFNCSWDGCDKKFARSDELSRHRRTHTGEKKFVCPVCDRRFMRSDHLTKHARRHMTTKKIPGWQAEVG    421 - 490
KLNRIASAESPGSPLVSMPASA                                                    491 - 512
//

Text Mined References (52)

PMID Year Title
25931269 2015 Promoter DNA methylation is associated with KLF11 expression in epithelial ovarian cancer.
25504365 2015 Browning of human adipocytes requires KLF11 and reprogramming of PPAR? superenhancers.
25502632 2015 Evidence revealing deregulation of the KLF11-MAO A pathway in association with chronic stress and depressive disorders.
25416956 2014 A proteome-scale map of the human interactome network.
25076120 2014 Epigenetic regulation of uterine biology by transcription factor KLF11 via posttranslational histone deacetylation of cytochrome p450 metabolic enzymes.
24885560 2014 Single and combinatorial chromatin coupling events underlies the function of transcript factor Krüppel-like factor 11 in the regulation of gene networks.
24069400 2013 Role for Krüppel-like transcription factor 11 in mesenchymal cell function and fibrosis.
24060634 2014 KLF11 epigenetically regulates glycodelin-A, a marker of endometrial biology via histone-modifying chromatin mechanisms.
23915421 2014 The expression of KLF11 (TIEG2), a monoamine oxidase B transcriptional activator in the prefrontal cortex of human alcohol dependence.
23589285 2013 Krüppel-like factor 11 regulates the expression of metabolic genes via an evolutionarily conserved protein interaction domain functionally disrupted in maturity onset diabetes of the young.
More...