Property Summary

NCBI Gene PubMed Count 139
PubMed Score 2011.86
PubTator Score 248.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Orofacial cleft 54 0.0 1.4
Disease Target Count
Tooth agenesis 44

Expression

  Differential Expression (10)

Disease log2 FC p
aldosterone-producing adenoma -1.201 1.3e-02
Breast cancer 2.900 2.6e-02
ductal carcinoma in situ 2.100 2.0e-02
interstitial cystitis -2.900 8.6e-03
intraductal papillary-mucinous neoplasm ... 1.200 6.9e-03
invasive ductal carcinoma 1.400 4.4e-02
non-small cell lung cancer 2.752 8.4e-17
pancreatic cancer 1.100 5.7e-04
pituitary cancer 1.100 1.7e-02
spina bifida -1.437 4.1e-02

Gene RIF (139)

AA Sequence

MALHPRRVRLKPWLVAQVDSGLYPGLIWLHRDSKRFQIPWKHATRHSPQQEEENTIFKAWAVETGKYQEG      1 - 70
VDDPDPAKWKAQLRCALNKSREFNLMYDGTKEVPMNPVKIYQVCDIPQPQGSIINPGSTGSAPWDEKDND     71 - 140
VDEEDEEDELDQSQHHVPIQDTFPFLNINGSPMAPASVGNCSVGNCSPEAVWPKTEPLEMEVPQAPIQPF    141 - 210
YSSPELWISSLPMTDLDIKFQYRGKEYGQTMTVSNPQGCRLFYGDLGPMPDQEELFGPVSLEQVKFPGPE    211 - 280
HITNEKQKLFTSKLLDVMDRGLILEVSGHAIYAIRLCQCKVYWSGPCAPSLVAPNLIERQKKVKLFCLET    281 - 350
FLSDLIAHQKGQIEKQPPFEIYLCFGEEWPDGKPLERKLILVQVIPVVARMIYEMFSGDFTRSFDSGSVR    351 - 420
LQISTPDIKDNIVAQLKQLYRILQTQESWQPMQPTPSMQLPPALPPQ                           421 - 467
//

Text Mined References (142)

PMID Year Title