Property Summary

NCBI Gene PubMed Count 123
Grant Count 343
R01 Count 170
Funding $50,849,647.65
PubMed Score 1852.77
PubTator Score 248.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Synonym

Accession O14896 B4DLE2 D3DT90 F5GWX8 G0ZTL0 IRF-6
Symbols LPS
PIT
PPS
VWS
OFC6
PPS1
VWS1

Gene

PANTHER Protein Class (1)

Gene RIF (124)

PMID Text
26819203 IRF6 is likely to promote inflammation to P. gingivalis through its regulation of IL-36gamma.
26710774 IRF6rs2235371 variation can increase the risk of nonsyndromic cleft lip/palate in the Iranian population.
26303210 Data suggest that the toll like receptor 3 (TLR3)-interferon regulatory factor 6 protein (IRF6)-interleukin-23 subunit p19 (p19)/EBI3 protein axis may regulate keratinocyte functions in the skin.
26161746 IRF6 acts as a positive regulator of proliferation and transformation in MCF10A cells downstream of Notch signaling.
26086926 Our results showed that many CL/P candidate genes have relation with Irf6, and 9 of these genes, including Msx1, Pvrl1, Pax9, Jag2, Irf6, Tgfb3, Rara, Gli2, and Tgfb2, were enriched into the CL/P gene group.
25896061 significant overrepresentation of tagSNP haplotype carrying rs642961 risk allele in most severe subphenotype of CL/P. recently shown that >80% of IRF6 mutations in syndromic CL/P occur on same haplotype. suggest IRF6 is marker of CL/P severity.
25896037 The IRF6 AP-2a binding site promoter polymorphism is associated with isolated oral clefts in Latvia.
25784454 The truncation of IRF6 also prevented the induction of its transactivator function by RIPK4.
25592222 genetic polymorphism of the IRF6 gene is associated with increased risk of nsCLP in a Xinjiang Uyghur population.
25579819 Genome-wide copy number scan identifies IRF6 involvement in Van der Woude syndrome in an Indian family.
More...

AA Sequence

MALHPRRVRLKPWLVAQVDSGLYPGLIWLHRDSKRFQIPWKHATRHSPQQEEENTIFKAWAVETGKYQEG      1 - 70
VDDPDPAKWKAQLRCALNKSREFNLMYDGTKEVPMNPVKIYQVCDIPQPQGSIINPGSTGSAPWDEKDND     71 - 140
VDEEDEEDELDQSQHHVPIQDTFPFLNINGSPMAPASVGNCSVGNCSPEAVWPKTEPLEMEVPQAPIQPF    141 - 210
YSSPELWISSLPMTDLDIKFQYRGKEYGQTMTVSNPQGCRLFYGDLGPMPDQEELFGPVSLEQVKFPGPE    211 - 280
HITNEKQKLFTSKLLDVMDRGLILEVSGHAIYAIRLCQCKVYWSGPCAPSLVAPNLIERQKKVKLFCLET    281 - 350
FLSDLIAHQKGQIEKQPPFEIYLCFGEEWPDGKPLERKLILVQVIPVVARMIYEMFSGDFTRSFDSGSVR    351 - 420
LQISTPDIKDNIVAQLKQLYRILQTQESWQPMQPTPSMQLPPALPPQ                           421 - 467
//

Text Mined References (126)

PMID Year Title
26819203 2016 IRF6 Regulates the Expression of IL-36? by Human Oral Epithelial Cells in Response to Porphyromonas gingivalis.
26710774 [Significant association between nonsyndromic cleft lip with or without cleft palate and IRF6rs2235371 polymorphism in Iranian familiar population].
26303210 2015 TLR3 drives IRF6-dependent IL-23p19 expression and p19/EBI3 heterodimer formation in keratinocytes.
26161746 2015 IRF6 Is Involved in the Regulation of Cell Proliferation and Transformation in MCF10A Cells Downstream of Notch Signaling.
26086926 2015 Irf6-Related Gene Regulatory Network Involved in Palate and Lip Development.
25896061 2015 IRF6 Is a Marker of Severity in Nonsyndromic Cleft Lip/Palate.
25896037 2014 IRF6 AP-2a binding site promoter polymorphism is associated with oral clefts in Latvia.
25784454 2015 Disease-associated mutations in IRF6 and RIPK4 dysregulate their signalling functions.
25592222 2015 Association of single-nucleotide polymorphisms in the IRF6 gene with non-syndromic cleft lip with or without cleft palate in the Xinjiang Uyghur population.
25579819 2014 Genome-wide copy number scan identifies IRF6 involvement in Van der Woude syndrome in an Indian family.
More...