Property Summary

NCBI Gene PubMed Count 30
PubMed Score 28.50
PubTator Score 19.86

Knowledge Summary

Patent

No data available

Expression

Gene RIF (19)

PMID Text
26531872 TM4SF5-miR-4697-3P- CTD-2354A18.1 may play a key role in the pathogenesis of gastric cancer
25772760 TM4SF5-positive tumors exhibited locally-increased CD44 expression, suggesting tumor cell differentiation
25627085 promotes self-renewal and circulating tumor cell properties
25268742 TM4SF5-specific monoclonal antibody has a therapeutic effect against colon cancer.
25033048 TM4SF5 interacted with CD151, and caused the internalization of CD63 from the cell surface.
24912675 TM4SF5 expression in SNU761 cells caused invasive extracellular matrix degradation negatively depending on IL-6/IL-6 receptor signaling.
23633159 TM4SF5 is positively associated with esophageal cancer invasiveness
23077174 Findings demonstrate that TM4SF5 directly binds to and activates FAK in an adhesion-dependent manner, to regulate cell migration and invasion in hepatocellular carcinoma.
22292774 results indicate that TGFbeta1- and growth factor-mediated signalling activities mediate TM4SF5 expression leading to acquisition of mesenchymal cell features, suggesting that TM4SF5 induction may be involved in the development of liver pathologies
22178131 Results indicate that TM4SF5-mediated epithelial-mesenchymal transition may have an important function in the gefitinib resistance of cancer cells.
More...

AA Sequence

MCTGKCARCVGLSLITLCLVCIVANALLLVPNGETSWTNTNHLSLQVWLMGGFIGGGLMVLCPGIAAVRA      1 - 70
GGKGCCGAGCCGNRCRMLRSVFSSAFGVLGAIYCLSVSGAGLRNGPRCLMNGEWGYHFEDTAGAYLLNRT     71 - 140
LWDRCEAPPRVVPWNVTLFSLLVAASCLEIVLCGIQLVNATIGVFCGDCRKKQDTPH                 141 - 197
//

Text Mined References (30)

PMID Year Title
26531872 2015 TM4SF5-CTD-2354A18.1-miR-4697-3P may play a key role in the pathogenesis of gastric cancer.
26404468 2015 Transmembrane 4 L Six Family Member 5 (TM4SF5)-Mediated Epithelial-Mesenchymal Transition in Liver Diseases.
25772760 2015 Self-renewal and circulating capacities of metastatic hepatocarcinoma cells required for collaboration between TM4SF5 and CD44.
25627085 2015 Interaction of tetraspan(in) TM4SF5 with CD44 promotes self-renewal and circulating capacities of hepatocarcinoma cells.
25268742 2014 Therapeutic effect of a TM4SF5-specific monoclonal antibody against colon cancer in a mouse model.
25033048 2014 Correlations between transmembrane 4 L6 family member 5 (TM4SF5), CD151, and CD63 in liver fibrotic phenotypes and hepatic migration and invasive capacities.
24912675 2014 Cross talk between the TM4SF5/focal adhesion kinase and the interleukin-6/STAT3 pathways promotes immune escape of human liver cancer cells.
23633159 2013 A high level of TM4SF5 is associated with human esophageal cancer progression and poor patient survival.
23077174 2012 Tetraspan TM4SF5-dependent direct activation of FAK and metastatic potential of hepatocarcinoma cells.
22916037 2012 Novel Loci for metabolic networks and multi-tissue expression studies reveal genes for atherosclerosis.
More...