Property Summary

NCBI Gene PubMed Count 31
PubMed Score 30.35
PubTator Score 19.86

Knowledge Summary

Patent

No data available

Expression

Gene RIF (20)

AA Sequence

MCTGKCARCVGLSLITLCLVCIVANALLLVPNGETSWTNTNHLSLQVWLMGGFIGGGLMVLCPGIAAVRA      1 - 70
GGKGCCGAGCCGNRCRMLRSVFSSAFGVLGAIYCLSVSGAGLRNGPRCLMNGEWGYHFEDTAGAYLLNRT     71 - 140
LWDRCEAPPRVVPWNVTLFSLLVAASCLEIVLCGIQLVNATIGVFCGDCRKKQDTPH                 141 - 197
//

Text Mined References (31)

PMID Year Title