Property Summary

NCBI Gene PubMed Count 17
PubMed Score 24.60
PubTator Score 11.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
tuberculosis 1563 6.78409541921997E-8
malignant mesothelioma 3163 1.72366582449755E-7
Breast cancer 3099 8.74182882565223E-6
psoriasis 6685 2.19158286134391E-5
ovarian cancer 8492 8.45666954445604E-5
lung cancer 4473 0.0068775641644069
osteosarcoma 7933 0.0101273662359772
astrocytic glioma 2241 0.012806934289793
non primary Sjogren syndrome sicca 840 0.033673225155871
oligodendroglioma 2849 0.047435130224575

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -1.700 0.000
astrocytic glioma -1.400 0.013
oligodendroglioma -1.100 0.047
psoriasis -1.900 0.000
osteosarcoma -1.142 0.010
tuberculosis 1.200 0.000
lung cancer 1.200 0.007
non primary Sjogren syndrome sicca 1.400 0.034
ovarian cancer -1.200 0.000
Breast cancer 1.100 0.000

Synonym

Accession O14880 B2R592 Q6ICN4 Microsomal GST-3
Symbols GST-III

Gene

PANTHER Protein Class (1)

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (5)

PMID Text
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of microsomal glutathione S-transferase 3 (MGST3) expression by HIV-1 Vpr in Vpr transduced macrophages
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19536175 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19064610 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAVLSKEYGFVLLTGAASFIMVAHLAINVSKARKKYKVEYPIMYSTDPENGHIFNCIQRAHQNTLEVYPP      1 - 70
FLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPSKRSRGALGSIALLGLVGTTVCSAFQHLGWV     71 - 140
KSGLGSGPKCCH                                                              141 - 152
//

Text Mined References (22)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
21116278 2011 Genome-wide association with MRI atrophy measures as a quantitative trait locus for Alzheimer's disease.
21044946 2011 Site-specific analysis of protein S-acylation by resin-assisted capture.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19946888 2010 Defining the membrane proteome of NK cells.
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
More...