Property Summary

NCBI Gene PubMed Count 17
PubMed Score 24.47
PubTator Score 11.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.400 1.3e-02
Breast cancer 1.100 8.7e-06
lung cancer 1.200 6.9e-03
malignant mesothelioma -1.700 1.7e-07
non primary Sjogren syndrome sicca 1.400 3.4e-02
oligodendroglioma -1.100 4.7e-02
osteosarcoma -1.142 1.0e-02
ovarian cancer -1.200 8.5e-05
psoriasis -1.900 2.2e-05
tuberculosis 1.200 6.8e-08

Protein-protein Interaction (11)

Gene RIF (5)

AA Sequence

MAVLSKEYGFVLLTGAASFIMVAHLAINVSKARKKYKVEYPIMYSTDPENGHIFNCIQRAHQNTLEVYPP      1 - 70
FLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPSKRSRGALGSIALLGLVGTTVCSAFQHLGWV     71 - 140
KSGLGSGPKCCH                                                              141 - 152
//

Text Mined References (22)

PMID Year Title