Property Summary

NCBI Gene PubMed Count 17
PubMed Score 24.60
PubTator Score 11.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -1.700 0.000
astrocytic glioma -1.400 0.013
oligodendroglioma -1.100 0.047
psoriasis -1.900 0.000
osteosarcoma -1.142 0.010
tuberculosis 1.200 0.000
lung cancer 1.200 0.007
non primary Sjogren syndrome sicca 1.400 0.034
ovarian cancer -1.200 0.000
Breast cancer 1.100 0.000

Synonym

Accession O14880 B2R592 Q6ICN4 Microsomal GST-3
Symbols GST-III

Gene

PANTHER Protein Class (1)

 GWAS Trait (1)

Gene RIF (5)

PMID Text
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of microsomal glutathione S-transferase 3 (MGST3) expression by HIV-1 Vpr in Vpr transduced macrophages
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19536175 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19064610 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAVLSKEYGFVLLTGAASFIMVAHLAINVSKARKKYKVEYPIMYSTDPENGHIFNCIQRAHQNTLEVYPP      1 - 70
FLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPSKRSRGALGSIALLGLVGTTVCSAFQHLGWV     71 - 140
KSGLGSGPKCCH                                                              141 - 152
//

Text Mined References (22)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
21116278 2011 Genome-wide association with MRI atrophy measures as a quantitative trait locus for Alzheimer's disease.
21044946 2011 Site-specific analysis of protein S-acylation by resin-assisted capture.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19946888 2010 Defining the membrane proteome of NK cells.
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
More...