Property Summary

NCBI Gene PubMed Count 34
Grant Count 10
R01 Count 6
Funding $655,200.48
PubMed Score 100.55
PubTator Score 212.15

Knowledge Summary

Patent

No data available

Expression

Gene RIF (25)

PMID Text
26686474 results indicated that RIG-G level was high in maturated cells and low in blast cells, and suggested that RIG-G might play a role in the differentiation of bone marrow hemocytes in vivo
26116899 HIV-1 Vpr upregulates the gene expression of IFIT3 in human monocyte-derived dendritic cells
25905045 Reovirus T3D infection induced STAT-1, ISG-15, IFIT-1, Mx1 and IFIT-3 expression.
25650658 The transcription factor SOX9, which is linked to regulation of hypoxia-related genes, was identified as a key mediator of upregulation of the oncogene IFIT3 and thereby sustaining a "pseudoinflammatory" cellular condition in pancreatic tumors.
25252956 HIV-1 Vpr upregulates the gene expression of IFIT3 in human monocyte-derived dendritic cells
25170834 HIV-1 Vpr upregulates the gene expression of IFIT3 in human monocyte-derived dendritic cells
25131332 In cell models of dengue virus 2 infection, authors found that IFITM3 contributed to both the baseline and interferon-induced inhibition of virus entry.
24742347 HIV-1 Vpr upregulates the gene expression of IFIT3 in human monocyte-derived dendritic cells
24742347 HIV-1 Vpr upregulates the gene expression of IFIT3 in human monocyte-derived dendritic cells
24223959 protective roles of IFIT3 following IFN-alpha production in DV infection of human lung epithelial cells
More...

AA Sequence

MSEVTKNSLEKILPQLKCHFTWNLFKEDSVSRDLEDRVCNQIEFLNTEFKATMYNLLAYIKHLDGNNEAA      1 - 70
LECLRQAEELIQQEHADQAEIRSLVTWGNYAWVYYHLGRLSDAQIYVDKVKQTCKKFSNPYSIEYSELDC     71 - 140
EEGWTQLKCGRNERAKVCFEKALEEKPNNPEFSSGLAIAMYHLDNHPEKQFSTDVLKQAIELSPDNQYVK    141 - 210
VLLGLKLQKMNKEAEGEQFVEEALEKSPCQTDVLRSAAKFYRRKGDLDKAIELFQRVLESTPNNGYLYHQ    211 - 280
IGCCYKAKVRQMQNTGESEASGNKEMIEALKQYAMDYSNKALEKGLNPLNAYSDLAEFLETECYQTPFNK    281 - 350
EVPDAEKQQSHQRYCNLQKYNGKSEDTAVQHGLEGLSISKKSTDKEEIKDQPQNVSENLLPQNAPNYWYL    351 - 420
QGLIHKQNGDLLQAAKCYEKELGRLLRDAPSGIGSIFLSASELEDGSEEMGQGAVSSSPRELLSNSEQLN    421 - 490
//

Text Mined References (40)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26686474 2016 RIG-G inhibits the proliferation of NB4 cells and propels ATRA-induced differentiation of APL cells.
25905045 2015 Comparative proteomic analyses demonstrate enhanced interferon and STAT-1 activation in reovirus T3D-infected HeLa cells.
25650658 2015 Overexpression of IFN-induced protein with tetratricopeptide repeats 3 (IFIT3) in pancreatic cancer: cellular "pseudoinflammation" contributing to an aggressive phenotype.
25416956 2014 A proteome-scale map of the human interactome network.
25131332 2015 IFITM3-containing exosome as a novel mediator for anti-viral response in dengue virus infection.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24223959 2013 Protective roles of interferon-induced protein with tetratricopeptide repeats 3 (IFIT3) in dengue virus infection of human lung epithelial cells.
23415865 2013 Rig-G negatively regulates SCF-E3 ligase activities by disrupting the assembly of COP9 signalosome complex.
23237964 2013 The broad-spectrum antiviral functions of IFIT and IFITM proteins.
More...