Property Summary

NCBI Gene PubMed Count 43
PubMed Score 108.04
PubTator Score 212.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
active Crohn's disease 1.151 3.5e-03
active ulcerative colitis 1.952 1.4e-02
astrocytoma 1.100 3.7e-06
Astrocytoma, Pilocytic 1.800 9.9e-07
autosomal dominant Emery-Dreifuss muscul... 1.019 1.3e-02
Breast cancer -1.200 3.6e-02
breast carcinoma 1.100 1.8e-11
cutaneous lupus erythematosus 3.400 1.4e-05
cystic fibrosis 2.000 4.8e-03
Duchenne muscular dystrophy 1.351 1.8e-04
ependymoma 1.300 8.0e-04
glioblastoma 1.200 1.5e-02
group 4 medulloblastoma -2.300 1.9e-05
interstitial cystitis 1.100 2.1e-02
invasive ductal carcinoma 1.586 3.0e-02
juvenile dermatomyositis 3.546 1.7e-17
lung cancer -2.100 3.0e-04
lung carcinoma -1.900 7.9e-15
medulloblastoma, large-cell -2.800 3.9e-06
nasopharyngeal carcinoma 2.100 8.4e-05
pancreatic cancer 1.100 1.1e-03
pediatric high grade glioma 1.100 9.5e-04
primary pancreatic ductal adenocarcinoma 1.296 3.0e-02
primary Sjogren syndrome 2.600 1.0e-05
psoriasis 1.500 7.8e-07
subependymal giant cell astrocytoma 2.474 7.2e-03
Systemic lupus erythematosus 1.900 1.3e-04

Synonym

Accession O14879 Q99634 Q9BSK7 IFIT-3
Symbols P60
IRG2
IFI60
IFIT4
ISG60
RIG-G
cig41
CIG-49
GARG-49

Gene

  Ortholog (1)

Species Source Disease
Chimp EggNOG Inparanoid

Gene RIF (30)

AA Sequence

MSEVTKNSLEKILPQLKCHFTWNLFKEDSVSRDLEDRVCNQIEFLNTEFKATMYNLLAYIKHLDGNNEAA      1 - 70
LECLRQAEELIQQEHADQAEIRSLVTWGNYAWVYYHLGRLSDAQIYVDKVKQTCKKFSNPYSIEYSELDC     71 - 140
EEGWTQLKCGRNERAKVCFEKALEEKPNNPEFSSGLAIAMYHLDNHPEKQFSTDVLKQAIELSPDNQYVK    141 - 210
VLLGLKLQKMNKEAEGEQFVEEALEKSPCQTDVLRSAAKFYRRKGDLDKAIELFQRVLESTPNNGYLYHQ    211 - 280
IGCCYKAKVRQMQNTGESEASGNKEMIEALKQYAMDYSNKALEKGLNPLNAYSDLAEFLETECYQTPFNK    281 - 350
EVPDAEKQQSHQRYCNLQKYNGKSEDTAVQHGLEGLSISKKSTDKEEIKDQPQNVSENLLPQNAPNYWYL    351 - 420
QGLIHKQNGDLLQAAKCYEKELGRLLRDAPSGIGSIFLSASELEDGSEEMGQGAVSSSPRELLSNSEQLN    421 - 490
//

Text Mined References (49)

PMID Year Title