Property Summary

NCBI Gene PubMed Count 73
PubMed Score 7.79
PubTator Score 86.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
aldosterone-producing adenoma -1.152 1.7e-02
Astrocytoma, Pilocytic 1.600 2.9e-07
Breast cancer -1.100 2.3e-07
dermatomyositis 1.100 8.1e-03
diabetes mellitus -1.100 8.3e-03
Gaucher disease type 1 -1.700 1.3e-02
glioblastoma 1.200 1.8e-06
group 4 medulloblastoma 1.400 2.8e-04
lung cancer -1.200 3.6e-04
lung carcinoma -1.300 3.7e-17
osteosarcoma 1.560 6.7e-03
ovarian cancer -2.000 1.6e-07
pediatric high grade glioma 1.400 3.6e-06
posterior fossa group A ependymoma 1.100 2.3e-05
primitive neuroectodermal tumor 1.400 3.5e-05
sarcoidosis 1.100 3.7e-02

Gene RIF (49)

AA Sequence

MSLSENSVFAYESSVHSTNVLLSLNDQRKKDVLCDVTIFVEGQRFRAHRSVLAACSSYFHSRIVGQADGE      1 - 70
LNITLPEEVTVKGFEPLIQFAYTAKLILSKENVDEVCKCVEFLSVHNIEESCFQFLKFKFLDSTADQQEC     71 - 140
PRKKCFSSHCQKTDLKLSLLDQRDLETDEVEEFLENKNVQTPQCKLRRYQGNAKASPPLQDSASQTYESM    141 - 210
CLEKDAALALPSLCPKYRKFQKAFGTDRVRTGESSVKDIHASVQPNERSENECLGGVPECRDLQVMLKCD    211 - 280
ESKLAMEPEETKKDPASQCPTEKSEVTPFPHNSSIDPHGLYSLSLLHTYDQYGDLNFAGMQNTTVLTEKP    281 - 350
LSGTDVQEKTFGESQDLPLKSDLGTREDSSVASSDRSSVEREVAEHLAKGFWSDICSTDTPCQMQLSPAV    351 - 420
AKDGSEQISQKRSECPWLGIRISESPEPGQRTFTTLSSVNCPFISTLSTEGCSSNLEIGNDDYVSEPQQE    421 - 490
PCPYACVISLGDDSETDTEGDSESCSAREQECEVKLPFNAQRIISLSRNDFQSLLKMHKLTPEQLDCIHD    491 - 560
IRRRSKNRIAAQRCRKRKLDCIQNLESEIEKLQSEKESLLKERDHILSTLGETKQNLTGLCQKVCKEAAL    561 - 630
SQEQIQILAKYSAADCPLSFLISEKDKSTPDGELALPSIFSLSDRPPAVLPPCARGNSEPGYARGQESQQ    631 - 700
MSTATSEQAGPAEQCRQSGGISDFCQQMTDKCTTDE                                      701 - 736
//

Text Mined References (76)

PMID Year Title