Property Summary

NCBI Gene PubMed Count 65
Grant Count 99
R01 Count 63
Funding $8,446,897.99
PubMed Score 7.38
PubTator Score 86.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
osteosarcoma 1.560 0.007
glioblastoma 1.800 0.001
group 4 medulloblastoma 1.400 0.000
primitive neuroectodermal tumor 1.400 0.000
lung cancer -1.200 0.000
sarcoidosis 1.100 0.037
diabetes mellitus -1.100 0.008
pediatric high grade glioma 1.400 0.000
pilocytic astrocytoma 1.600 0.000
posterior fossa group A ependymoma 1.100 0.000
aldosterone-producing adenoma -1.152 0.017
lung carcinoma -1.300 0.000
Breast cancer -1.100 0.000
ovarian cancer -2.000 0.000
Gaucher disease type 1 -1.700 0.013
dermatomyositis 1.100 0.008

Synonym

Accession O14867 O43285 Q6ICU0
Symbols BACH-1
BTBD24

Gene

PDB

2IHC  

Gene RIF (41)

PMID Text
26445536 heme oxygenase-1 expression is induced by gold nanoparticles through Nrf2 activation and Bach1 export in human vascular endothelial cells
26422990 Cyanidin-3-O-glucoside protects HUVECs from palmitic acid-induced injuryby modulating the balance of Nrf2 versus Bach1 inside the nucleus so influencing upregulation of electrophile responsive element mediated gene expression.
26244607 sensitizer-induced up-regulation of both the endogenous HMOX1 and the luciferase constructs under the control of the HMOX1-ARE or the full HMOX1 promoter appear to be under the control of both Nrf2 and Bach1.
26123998 Bach1 suppresses angiogenesis after ischemic injury and impairs Wnt/beta-catenin signaling by disrupting the interaction between beta-catenin and TCF4 and by recruiting histone deacetylase 1 to the promoter of TCF4-targeted genes.
25391381 This study demonstrated that Bach1 overexpression in Down syndrome correlates with the alteration of the HO-1/BVR-a system.
24752012 Higher HMOX1 expression correlated with higher expression of Bach-1 (Spearman's rho = 0.586, p = 0.000001) and miR-122 (Spearman's rho = 0.270, p = 0.014059).
24613679 The Bach1-dependent repression of the HO-1 expression is under the control of the Hx-dependent uptake of extracellular heme
24395801 BACH1 acts in a double-negative (overall positive) feedback loop to inhibit RKIP transcription in breast cancer cells
24366869 CXCR3-B mediates a growth-inhibitory signal in breast cancer cells through the modulations of nuclear translocation of Bach-1 and Nrf2 and down-regulation of HO-1.
24035498 Identify a role for SCF(FBXL17) in controlling the threshold for NRF2-dependent gene activation via BACH1 repressor turnover.
More...

AA Sequence

MSLSENSVFAYESSVHSTNVLLSLNDQRKKDVLCDVTIFVEGQRFRAHRSVLAACSSYFHSRIVGQADGE      1 - 70
LNITLPEEVTVKGFEPLIQFAYTAKLILSKENVDEVCKCVEFLSVHNIEESCFQFLKFKFLDSTADQQEC     71 - 140
PRKKCFSSHCQKTDLKLSLLDQRDLETDEVEEFLENKNVQTPQCKLRRYQGNAKASPPLQDSASQTYESM    141 - 210
CLEKDAALALPSLCPKYRKFQKAFGTDRVRTGESSVKDIHASVQPNERSENECLGGVPECRDLQVMLKCD    211 - 280
ESKLAMEPEETKKDPASQCPTEKSEVTPFPHNSSIDPHGLYSLSLLHTYDQYGDLNFAGMQNTTVLTEKP    281 - 350
LSGTDVQEKTFGESQDLPLKSDLGTREDSSVASSDRSSVEREVAEHLAKGFWSDICSTDTPCQMQLSPAV    351 - 420
AKDGSEQISQKRSECPWLGIRISESPEPGQRTFTTLSSVNCPFISTLSTEGCSSNLEIGNDDYVSEPQQE    421 - 490
PCPYACVISLGDDSETDTEGDSESCSAREQECEVKLPFNAQRIISLSRNDFQSLLKMHKLTPEQLDCIHD    491 - 560
IRRRSKNRIAAQRCRKRKLDCIQNLESEIEKLQSEKESLLKERDHILSTLGETKQNLTGLCQKVCKEAAL    561 - 630
SQEQIQILAKYSAADCPLSFLISEKDKSTPDGELALPSIFSLSDRPPAVLPPCARGNSEPGYARGQESQQ    631 - 700
MSTATSEQAGPAEQCRQSGGISDFCQQMTDKCTTDE                                      701 - 736
//

Text Mined References (68)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26445536 2015 Gold nanoparticles induce heme oxygenase-1 expression through Nrf2 activation and Bach1 export in human vascular endothelial cells.
26422990 2015 Palmitate-induced endothelial dysfunction is attenuated by cyanidin-3-O-glucoside through modulation of Nrf2/Bach1 and NF-?B pathways.
26244607 2015 Dual regulation of skin sensitizer-induced HMOX1 expression by Bach1 and Nrf2: Comparison to regulation of the AKR1C2-ARE element in the KeratinoSens cell line.
26123998 2015 Bach1 Represses Wnt/?-Catenin Signaling and Angiogenesis.
25391381 2015 Bach1 overexpression in Down syndrome correlates with the alteration of the HO-1/BVR-a system: insights for transition to Alzheimer's disease.
24752012 2014 Hepatic HMOX1 expression positively correlates with Bach-1 and miR-122 in patients with HCV mono and HIV/HCV coinfection.
24613679 2014 Hemopexin-dependent heme uptake via endocytosis regulates the Bach1 transcription repressor and heme oxygenase gene activation.
24395801 2014 Network of mutually repressive metastasis regulators can promote cell heterogeneity and metastatic transitions.
24366869 2014 A novel CXCR3-B chemokine receptor-induced growth-inhibitory signal in cancer cells is mediated through the regulation of Bach-1 protein and Nrf2 protein nuclear translocation.
More...