Property Summary

NCBI Gene PubMed Count 25
PubMed Score 33.64
PubTator Score 26.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.400 8.5e-04
astrocytic glioma -1.500 1.6e-02
atypical teratoid / rhabdoid tumor -1.800 1.9e-06
colon cancer -1.500 2.5e-02
ependymoma -2.000 1.7e-02
glioblastoma -1.100 7.9e-05
lung cancer -1.200 1.1e-02
malignant mesothelioma -2.200 1.2e-07
medulloblastoma -1.100 8.7e-04
medulloblastoma, large-cell -3.100 4.1e-06
ovarian cancer -4.100 1.2e-16
pancreatic ductal adenocarcinoma liver m... -1.025 1.2e-03
primitive neuroectodermal tumor -1.400 1.6e-03
ulcerative colitis -1.300 7.2e-05

Pathway (1)

Protein-protein Interaction (10)

Gene RIF (19)

AA Sequence

MAGSGAWKRLKSMLRKDDAPLFLNDTSAFDFSDEAGDEGLSRFNKLRVVVADDGSEAPERPVNGAHPTLQ      1 - 70
ADDDSLLDQDLPLTNSQLSLKVDSCDNCSKQREILKQRKVKARLTIAAVLYLLFMIGELVGGYIANSLAI     71 - 140
MTDALHMLTDLSAIILTLLALWLSSKSPTKRFTFGFHRLEVLSAMISVLLVYILMGFLLYEAVQRTIHMN    141 - 210
YEINGDIMLITAAVGVAVNVIMGFLLNQSGHRHSHSHSLPSNSPTRGSGCERNHGQDSLAVRAAFVHALG    211 - 280
DLVQSVGVLIAAYIIRFKPEYKIADPICTYVFSLLVAFTTFRIIWDTVVIILEGVPSHLNVDYIKEALMK    281 - 350
IEDVYSVEDLNIWSLTSGKSTAIVHIQLIPGSSSKWEEVQSKANHLLLNTFGMYRCTIQLQSYRQEVDRT    351 - 420
CANCQSSSP                                                                 421 - 429
//

Text Mined References (27)

PMID Year Title