Property Summary

NCBI Gene PubMed Count 22
Grant Count 1
Funding $4,052.25
PubMed Score 32.56
PubTator Score 26.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma -2.200 0.000
astrocytic glioma -1.500 0.016
ependymoma -2.000 0.017
glioblastoma -1.900 0.000
medulloblastoma -1.700 0.000
atypical teratoid / rhabdoid tumor -1.800 0.000
medulloblastoma, large-cell -3.100 0.000
primitive neuroectodermal tumor -1.400 0.002
pancreatic ductal adenocarcinoma liver m... -1.025 0.001
colon cancer -1.500 0.025
lung cancer -1.200 0.011
pediatric high grade glioma -1.400 0.000
ulcerative colitis -1.400 0.000
ovarian cancer -4.100 0.000

Synonym

Accession O14863 Q8TC39 ZnT-4
Symbols ZNT4
znT-4

Gene

PANTHER Protein Class (1)

 Grant Application (1)

Gene RIF (18)

PMID Text
23368743 TRPML1 works in concert with ZnT4 to regulate zinc translocation between the cytoplasm and lysosomes.
22632162 FITC-labeled Tat 47-59 peptide downregulates gene expression of solute carrier family 30 (zinc transporter), member 4 (SLC30A4) in U-937 macrophages
22254085 The loss of ZnT4 in airway inflammation contributes to airway epithelium vulnerability in diseases such as asthma.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19371353 our results suggest that alterations in Zn transport proteins ZnT-1, ZnT-4 and ZnT-6 may contribute to the pathology observed in preclinical Alzheimer's disease subjects before onset of clinical symptoms
19058789 Observational study of gene-disease association. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18639746 Data show that ZNT4 is extensively present in the Abeta-positive plaques in the cortex of human AD brains.
17971500 hZnT-4 is found in the plasma membrane. It is most highly expressed in Molt-4 cells, up-regulated after treatment with phytohemagglutinin & is responsible for the measured decrease of intracellular zinc content after high zinc exposure.
More...

AA Sequence

MAGSGAWKRLKSMLRKDDAPLFLNDTSAFDFSDEAGDEGLSRFNKLRVVVADDGSEAPERPVNGAHPTLQ      1 - 70
ADDDSLLDQDLPLTNSQLSLKVDSCDNCSKQREILKQRKVKARLTIAAVLYLLFMIGELVGGYIANSLAI     71 - 140
MTDALHMLTDLSAIILTLLALWLSSKSPTKRFTFGFHRLEVLSAMISVLLVYILMGFLLYEAVQRTIHMN    141 - 210
YEINGDIMLITAAVGVAVNVIMGFLLNQSGHRHSHSHSLPSNSPTRGSGCERNHGQDSLAVRAAFVHALG    211 - 280
DLVQSVGVLIAAYIIRFKPEYKIADPICTYVFSLLVAFTTFRIIWDTVVIILEGVPSHLNVDYIKEALMK    281 - 350
IEDVYSVEDLNIWSLTSGKSTAIVHIQLIPGSSSKWEEVQSKANHLLLNTFGMYRCTIQLQSYRQEVDRT    351 - 420
CANCQSSSP                                                                 421 - 429
//

Text Mined References (24)

PMID Year Title
23368743 2013 Zinc-dependent lysosomal enlargement in TRPML1-deficient cells involves MTF-1 transcription factor and ZnT4 (Slc30a4) transporter.
23149075 2013 Preliminary evidence of genetic determinants of adiponectin response to fenofibrate in the Genetics of Lipid Lowering Drugs and Diet Network.
22254085 2011 Apical localization of zinc transporter ZnT4 in human airway epithelial cells and its loss in a murine model of allergic airway inflammation.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19371353 2010 Alterations of zinc transporter proteins ZnT-1, ZnT-4 and ZnT-6 in preclinical Alzheimer's disease brain.
19058789 2009 A common variant in DRD3 receptor is associated with autism spectrum disorder.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18639746 2008 Abundant expression of zinc transporters in the amyloid plaques of Alzheimer's disease brain.
17971500 2008 Intracellular zinc homeostasis in leukocyte subsets is regulated by different expression of zinc exporters ZnT-1 to ZnT-9.
More...