Property Summary

NCBI Gene PubMed Count 57
PubMed Score 140.74
PubTator Score 117.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
psoriasis 6685 7.48200442715095E-112
lung adenocarcinoma 2714 3.17867971475396E-8
chronic lymphosyte leukemia 232 1.11516946757423E-6
ulcerative colitis 2087 1.43216961991561E-6
cutaneous lupus erythematosus 1056 2.52747979357402E-6
group 3 medulloblastoma 2254 7.52249566831255E-5
pituitary cancer 1972 9.22120563038768E-5
posterior fossa group B ependymoma 1530 9.75744198348578E-5
non-small cell lung cancer 2798 1.06005183047026E-4
ovarian cancer 8492 3.18562700907555E-4
lung cancer 4473 5.9552769186095E-4
primary Sjogren syndrome 789 0.00121273975259143
interstitial cystitis 2299 0.00366894504613485
tuberculosis 1563 0.00406139961578193
hepatocellular carcinoma 550 0.00455437633600158
subependymal giant cell astrocytoma 2287 0.0118143547516399
invasive ductal carcinoma 2950 0.0147812546670378
head and neck cancer and chronic obstructive pulmonary disease 237 0.0191521219109958
cystic fibrosis 1670 0.0245375183726357
mucosa-associated lymphoid tissue lymphoma 480 0.0298714135539353
sarcoidosis 368 0.0391812970160386
Disease Target Count Z-score Confidence
Tularemia 22 4.033 2.0
Lupus erythematosus 80 3.368 1.7
Gout 93 3.003 1.5

Expression

Synonym

Accession O14862 A8K7M7 Q5T3V9 Q96FG9
Symbols PYHIN4

Gene

PDB

3RN2   3RN5   3VD8   4O7Q  

  Ortholog (4)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid

 GO Function (1)

 GWAS Trait (1)

Gene RIF (44)

PMID Text
27037024 Molecular docking analysis reveals that the conformation switching may be important for the autoinhibition of the AIM2 protein.
26506473 Lung tumor-associated plasmacytoid dendritic cells (pDCs) are responsive to the activation of AIM2 that promotes calcium efflux and reactive oxygen species from mitochondria, leading to calpain activation and high levels of IL-1alpha.
26378020 The extent of NLRC3 and AIM2 gene reduction was correlated with cancer progression.
26313692 A significant upregulation of the PYHIN inflammasomes AIM2 and IFI16 in active inflammatory bowel disease versus controls was found.
26258904 analysis of a subset of inflammasome receptors including NLRP3, NLRC4 and AIM2 that triggers formation of the micrometer-sized spherical supramolecular complex called the ASC speck
26197926 pyrin domain drives both filament formation and dsDNA binding
25888795 The comparison shows mouse AIM2 PYD domain adopts a unique alpha2-alpha3 helix conformation distinct from its human homologues, but similar to the pyrin domain of human NLRP10/PYNOD, which belongs to another family.
25173967 activation of the AIM2 inflammasome did not require a priming signal in ascitic fluid-derived macrophages, demonstrating the preactivated state of the inflammasome in these cells.
25164813 EB1 has a role in linking AIM2 inflammasomes with autophagy-dependent secretion
24986444 These results suggest that AIM2 expressed in human dental pulp plays an important role in the immune defense by activating the inflammasome signaling pathway.
More...

AA Sequence

MESKYKEILLLTGLDNITDEELDRFKFFLSDEFNIATGKLHTANRIQVATLMIQNAGAVSAVMKTIRIFQ      1 - 70
KLNYMLLAKRLQEEKEKVDKQYKSVTKPKPLSQAEMSPAASAAIRNDVAKQRAAPKVSPHVKPEQKQMVA     71 - 140
QQESIREGFQKRCLPVMVLKAKKPFTFETQEGKQEMFHATVATEKEFFFVKVFNTLLKDKFIPKRIIIIA    141 - 210
RYYRHSGFLEVNSASRVLDAESDQKVNVPLNIIRKAGETPKINTLQTQPLGTIVNGLFVVQKVTEKKKNI    211 - 280
LFDLSDNTGKMEVLGVRNEDTMKCKEGDKVRLTFFTLSKNGEKLQLTSGVHSTIKVIKAKKKT           281 - 343
//

Text Mined References (61)

PMID Year Title
27037024 2016 Conformation switching of AIM2 PYD domain revealed by NMR relaxation and MD simulation.
26506473 2015 Human lung cancer-derived immunosuppressive plasmacytoid dendritic cells release IL-1? in an AIM2 inflammasome-dependent manner.
26378020 2015 Expression profile of innate immune receptors, NLRs and AIM2, in human colorectal cancer: correlation with cancer stages and inflammasome components.
26313692 2015 Strong Upregulation of AIM2 and IFI16 Inflammasomes in the Mucosa of Patients with Active Inflammatory Bowel Disease.
26258904 2015 Artificial Loading of ASC Specks with Cytosolic Antigens.
26197926 2015 Assembly-driven activation of the AIM2 foreign-dsDNA sensor provides a polymerization template for downstream ASC.
25888795 2015 The NMR solution structure of AIM2 PYD domain from Mus musculus reveals a distinct ?2-?3 helix conformation from its human homologues.
25173967 2015 Absent in melanoma 2 triggers a heightened inflammasome response in ascitic fluid macrophages of patients with cirrhosis.
25164813 2014 The microtubule-associated protein EB1 links AIM2 inflammasomes with autophagy-dependent secretion.
24986444 2015 Absent in melanoma 2 (AIM2) expressed in human dental pulp mediates IL-1? secretion in response to cytoplasmic DNA.
More...