Property Summary

NCBI Gene PubMed Count 69
PubMed Score 165.66
PubTator Score 117.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.027 1.1e-02
cutaneous lupus erythematosus 5.400 2.5e-06
cystic fibrosis 1.100 2.5e-02
group 3 medulloblastoma 1.500 7.5e-05
head and neck cancer and chronic obstruc... 1.400 1.9e-02
hepatocellular carcinoma 1.100 4.6e-03
interstitial cystitis 3.300 3.7e-03
invasive ductal carcinoma 1.200 1.5e-02
lung adenocarcinoma 1.800 3.2e-08
lung cancer -1.600 6.0e-04
mucosa-associated lymphoid tissue lympho... 1.612 3.0e-02
non-small cell lung cancer 1.107 1.1e-04
ovarian cancer 1.300 3.2e-04
pituitary cancer 1.100 9.2e-05
posterior fossa group B ependymoma 1.300 9.8e-05
primary Sjogren syndrome 1.900 1.2e-03
psoriasis 2.400 8.2e-05
sarcoidosis 1.600 3.9e-02
subependymal giant cell astrocytoma 1.184 1.2e-02
tuberculosis 1.400 4.1e-03
ulcerative colitis 3.100 1.4e-06

Gene RIF (54)

AA Sequence

MESKYKEILLLTGLDNITDEELDRFKFFLSDEFNIATGKLHTANRIQVATLMIQNAGAVSAVMKTIRIFQ      1 - 70
KLNYMLLAKRLQEEKEKVDKQYKSVTKPKPLSQAEMSPAASAAIRNDVAKQRAAPKVSPHVKPEQKQMVA     71 - 140
QQESIREGFQKRCLPVMVLKAKKPFTFETQEGKQEMFHATVATEKEFFFVKVFNTLLKDKFIPKRIIIIA    141 - 210
RYYRHSGFLEVNSASRVLDAESDQKVNVPLNIIRKAGETPKINTLQTQPLGTIVNGLFVVQKVTEKKKNI    211 - 280
LFDLSDNTGKMEVLGVRNEDTMKCKEGDKVRLTFFTLSKNGEKLQLTSGVHSTIKVIKAKKKT           281 - 343
//

Text Mined References (73)

PMID Year Title