Property Summary

NCBI Gene PubMed Count 23
Grant Count 6
R01 Count 1
Funding $1,674,870.48
PubMed Score 48.76
PubTator Score 34.61

Knowledge Summary

Patent (4,253)

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Obesity 616 3.883 1.9
diabetes mellitus 1,663 3.24 1.6

Expression

Gene RIF (14)

PMID Text
26260360 Our data suggest that GPR42 be reclassified as a functioning gene and that recognition of sequence and copy number polymorphism of the FFAR3/GPR42 complex be considered during genetic and pharmacological investigation of these receptors.
25581519 FFAR3 is expressed in pancreatic beta cells and mediates an inhibition of insulin secretion by coupling to Gi-type G proteins.
24325907 a significant correlation between a higher body mass index and lower methylation in the promoter region of FFAR3 in type 2 diabetes and obesity patients
23066016 Extracellular ionic locks determine variation in constitutive activity and ligand potency between species orthologs of the free fatty acid receptors FFA2 and FFA3
22884094 GPR41 activation inhibits histone acetylation and cell growth.
22712802 Propionate-stimulated GPR41 strongly coupled to ERK1/2 activation, while the coupling of linoleic acid-activated GPR40 and acetate-activated GPR43 was weaker.
22493486 GPR41 gene expression is mediated by internal ribosome entry site (IRES)-dependent translation of bicistronic mRNA encoding GPR40 and GPR41 proteins
21220428 Selective orthosteric free fatty acid receptor 2 (FFA2) agonists: identification of the structural and chemical requirements for selective activation of FFA2 versus FFA3.
19630535 Study presents evidence showing that the six amino acid differences, including that R/W174 are polymorphisms rather than gene-specific differences between GPR41 and GPR42.
19574715 Results suggest that GPR41 expressed in human colonic mucosa may function as a sensor for luminal short-chain fatty acids.
More...

AA Sequence

MDTGPDQSYFSGNHWFVFSVYLLTFLVGLPLNLLALVVFVGKLQRRPVAVDVLLLNLTASDLLLLLFLPF      1 - 70
RMVEAANGMHWPLPFILCPLSGFIFFTTIYLTALFLAAVSIERFLSVAHPLWYKTRPRLGQAGLVSVACW     71 - 140
LLASAHCSVVYVIEFSGDISHSQGTNGTCYLEFRKDQLAILLPVRLEMAVVLFVVPLIITSYCYSRLVWI    141 - 210
LGRGGSHRRQRRVAGLLAATLLNFLVCFGPYNVSHVVGYICGESPAWRIYVTLLSTLNSCVDPFVYYFSS    211 - 280
SGFQADFHELLRRLCGLWGQWQQESSMELKEQKGGEEQRADRPAERKTSEHSQGCGTGGQVACAES        281 - 346
//

Text Mined References (25)

PMID Year Title
26260360 2015 Human GPR42 is a transcribed multisite variant that exhibits copy number polymorphism and is functional when heterologously expressed.
25581519 2015 Loss of FFA2 and FFA3 increases insulin secretion and improves glucose tolerance in type 2 diabetes.
24325907 2014 Effects of short chain fatty acid producing bacteria on epigenetic regulation of FFAR3 in type 2 diabetes and obesity.
23066016 2012 Extracellular ionic locks determine variation in constitutive activity and ligand potency between species orthologs of the free fatty acid receptors FFA2 and FFA3.
22884094 2012 Butyrate-induced GPR41 activation inhibits histone acetylation and cell growth.
22712802 2012 Receptor-specific regulation of ERK1/2 activation by members of the "free fatty acid receptor" family.
22493486 2012 GPR41 gene expression is mediated by internal ribosome entry site (IRES)-dependent translation of bicistronic mRNA encoding GPR40 and GPR41 proteins.
21518883 2011 Short-chain fatty acids and ketones directly regulate sympathetic nervous system via G protein-coupled receptor 41 (GPR41).
21220428 2011 Selective orthosteric free fatty acid receptor 2 (FFA2) agonists: identification of the structural and chemical requirements for selective activation of FFA2 versus FFA3.
19630535 2009 Sequence polymorphisms provide a common consensus sequence for GPR41 and GPR42.
More...