Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.81
PubTator Score 2.28

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O14830 O14831 PPEF-2
Symbols PPP7CB

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA Inparanoid
Opossum OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
C. elegans OMA EggNOG

Gene RIF (1)

PMID Text
20674765 Data suggest that, despite structural divergence, PPEF and PP5 phosphatases may share common interacting partners and functions.

AA Sequence

MGSGTSTQHHFAFQNAERAFKAAALIQRWYRRYVARLEMRRRCTWSIFQSIEYAGQQDQVKLHDFFSYLM      1 - 70
DHFIPSSHNDRDFLTRIFTEDRFAQDSEMKKCSDYESIEVPDSYTGPRLSFPLLPDHATALVEAFRLKQQ     71 - 140
LHARYVLNLLYETKKHLVQLPNINRVSTCYSEEITVCGDLHGQLDDLIFIFYKNGLPSPERSYVFNGDFV    141 - 210
DRGKDSVEILMILFAFMLVYPKEFHLNRGNHEDHMVNLRYGFTKEVMNKYKVHGKEILRTLQDVFCWLPL    211 - 280
ATLIDEKVLILHGGVSDITDLELLDKIERSKIVSTMRCKTRQKSEKQMEEKRRANQKSSAQGPIPWFLPE    281 - 350
SRSLPSSPLRLGSYKAQKTSRSSSIPCSGSLDGRELSRQVRSSVELELERCRQQAGLLVTGEKEEPSRSA    351 - 420
SEADSEAGELRKPTQEEWRQVVDILWSDPMAQEGCKANTIRGGGCYFGPDVTQQLLQKYNMQFLIRSHEC    421 - 490
KPEGYEFCHNRKVLTIFSASNYYEVGSNRGAYVKLGPALTPHIVQYQANKVTHTLTMRQRISRVEESALR    491 - 560
ALREKLFAHSSDLLSEFKKHDADKVGLITLSDWAAAVESVLHLGLPWRMLRPQLVNSSADNMLEYKSWLK    561 - 630
NLAKEQLSRENIQSSLLETLYRNRSNLETIFRIIDSDHSGFISLDEFRQTWKLFSSHMNIDITDDCICDL    631 - 700
ARSIDFNKDGHIDINEFLEAFRLVEKSCPEGDASECPQATNAKDSGCSSPGAH                     701 - 753
//

Text Mined References (6)

PMID Year Title
20674765 2010 Protein phosphatase with EF-hand domains 2 (PPEF2) is a potent negative regulator of apoptosis signal regulating kinase-1 (ASK1).
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12051765 2002 Protein Ser/Thr phosphatases PPEF interact with calmodulin.
11713293 2001 Normal light response, photoreceptor integrity, and rhodopsin dephosphorylation in mice lacking both protein phosphatases with EF hands (PPEF-1 and PPEF-2).
9326663 1997 Identification and characterization of a conserved family of protein serine/threonine phosphatases homologous to Drosophila retinal degeneration C.