Property Summary

NCBI Gene PubMed Count 12
Grant Count 29
R01 Count 12
Funding $6,616,897.43
PubMed Score 91.76
PubTator Score 33.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.500 0.010
ependymoma -1.900 0.000
oligodendroglioma -1.700 0.004
glioblastoma -2.100 0.001
group 4 medulloblastoma -2.000 0.009
atypical teratoid / rhabdoid tumor -1.800 0.001
primitive neuroectodermal tumor -2.300 0.005
pediatric high grade glioma -1.900 0.001
pilocytic astrocytoma -2.100 0.000

Gene RIF (1)

PMID Text
22292511 PPEF-1V is a 350bp deletion in the nucleotide sequence of PPEF-1 from 128-477bp and a 152-amino-acid N-terminal deletion in the amino acid sequence of PPEF-1.

AA Sequence

MGCSSSSTKTRRSDTSLRAALIIQNWYRGYKARLKARQHYALTIFQSIEYADEQGQMQLSTFFSFMLENY      1 - 70
THIHKEELELRNQSLESEQDMRDRWDYVDSIDVPDSYNGPRLQFPLTCTDIDLLLEAFKEQQILHAHYVL     71 - 140
EVLFETKKVLKQMPNFTHIQTSPSKEVTICGDLHGKLDDLFLIFYKNGLPSERNPYVFNGDFVDRGKNSI    141 - 210
EILMILCVSFLVYPNDLHLNRGNHEDFMMNLRYGFTKEILHKYKLHGKRILQILEEFYAWLPIGTIVDNE    211 - 280
ILVIHGGISETTDLNLLHRVERNKMKSVLIPPTETNRDHDTDSKHNKVGVTFNAHGRIKTNGSPTEHLTE    281 - 350
HEWEQIIDILWSDPRGKNGCFPNTCRGGGCYFGPDVTSKILNKYQLKMLIRSHECKPEGYEICHDGKVVT    351 - 420
IFSASNYYEEGSNRGAYIKLCSGTTPRFFQYQVTKATCFQPLRQRVDTMENSAIKILRERVISRKSDLTR    421 - 490
AFQLQDHRKSGKLSVSQWAFCMENILGLNLPWRSLSSNLVNIDQNGNVEYMSSFQNIRIEKPVQEAHSTL    491 - 560
VETLYRYRSDLEIIFNAIDTDHSGLISVEEFRAMWKLFSSHYNVHIDDSQVNKLANIMDLNKDGSIDFNE    561 - 630
FLKAFYVVHRYEDLMKPDVTNLG                                                   631 - 653
//

Text Mined References (13)

PMID Year Title
22292511 2012 Molecular cloning of a novel PPEF-1 gene variant from a T-cell lymphoblastic lymphoma cell line.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14759258 2004 An unappreciated role for RNA surveillance.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12051765 2002 Protein Ser/Thr phosphatases PPEF interact with calmodulin.
11713293 2001 Normal light response, photoreceptor integrity, and rhodopsin dephosphorylation in mice lacking both protein phosphatases with EF hands (PPEF-1 and PPEF-2).
10617768 2000 Effects of serine/threonine protein phosphatases on ion channels in excitable membranes.
More...