Property Summary

NCBI Gene PubMed Count 12
PubMed Score 100.58
PubTator Score 33.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.900 1.2e-02
astrocytic glioma -1.500 9.6e-03
Astrocytoma, Pilocytic -2.000 3.6e-04
atypical teratoid / rhabdoid tumor -1.800 7.0e-04
ependymoma -1.600 1.1e-02
glioblastoma -1.800 5.6e-06
group 4 medulloblastoma -2.000 9.2e-03
oligodendroglioma -1.700 3.9e-03
primitive neuroectodermal tumor -2.300 4.6e-03

Gene RIF (1)

AA Sequence

MGCSSSSTKTRRSDTSLRAALIIQNWYRGYKARLKARQHYALTIFQSIEYADEQGQMQLSTFFSFMLENY      1 - 70
THIHKEELELRNQSLESEQDMRDRWDYVDSIDVPDSYNGPRLQFPLTCTDIDLLLEAFKEQQILHAHYVL     71 - 140
EVLFETKKVLKQMPNFTHIQTSPSKEVTICGDLHGKLDDLFLIFYKNGLPSERNPYVFNGDFVDRGKNSI    141 - 210
EILMILCVSFLVYPNDLHLNRGNHEDFMMNLRYGFTKEILHKYKLHGKRILQILEEFYAWLPIGTIVDNE    211 - 280
ILVIHGGISETTDLNLLHRVERNKMKSVLIPPTETNRDHDTDSKHNKVGVTFNAHGRIKTNGSPTEHLTE    281 - 350
HEWEQIIDILWSDPRGKNGCFPNTCRGGGCYFGPDVTSKILNKYQLKMLIRSHECKPEGYEICHDGKVVT    351 - 420
IFSASNYYEEGSNRGAYIKLCSGTTPRFFQYQVTKATCFQPLRQRVDTMENSAIKILRERVISRKSDLTR    421 - 490
AFQLQDHRKSGKLSVSQWAFCMENILGLNLPWRSLSSNLVNIDQNGNVEYMSSFQNIRIEKPVQEAHSTL    491 - 560
VETLYRYRSDLEIIFNAIDTDHSGLISVEEFRAMWKLFSSHYNVHIDDSQVNKLANIMDLNKDGSIDFNE    561 - 630
FLKAFYVVHRYEDLMKPDVTNLG                                                   631 - 653
//

Text Mined References (13)

PMID Year Title