Property Summary

NCBI Gene PubMed Count 20
PubMed Score 11.95
PubTator Score 4.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 1.6e-05
lung cancer 4740 6.4e-03
Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 3.0
Gastrointestinal system disease 54 0.0 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer 1.100 6.4e-03
ovarian cancer 1.600 1.6e-05

Gene RIF (8)

AA Sequence

MAQSRDGGNPFAEPSELDNPFQDPAVIQHRPSRQYATLDVYNPFETREPPPAYEPPAPAPLPPPSAPSLQ      1 - 70
PSRKLSPTEPKNYGSYSTQASAAAATAELLKKQEELNRKAEELDRRERELQHAALGGTATRQNNWPPLPS     71 - 140
FCPVQPCFFQDISMEIPQEFQKTVSTMYYLWMCSTLALLLNFLACLASFCVETNNGAGFGLSILWVLLFT    141 - 210
PCSFVCWYRPMYKAFRSDSSFNFFVFFFIFFVQDVLFVLQAIGIPGWGFSGWISALVVPKGNTAVSVLML    211 - 280
LVALLFTGIAVLGIVMLKRIHSLYRRTGASFQKAQQEFAAGVFSNPAVRTAAANAAAGAAENAFRAP       281 - 347
//

Text Mined References (30)

PMID Year Title