Property Summary

NCBI Gene PubMed Count 28
Grant Count 5
R01 Count 5
Funding $862,336.66
PubMed Score 22.39
PubTator Score 16.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
astrocytic glioma -3.500 0.001
ependymoma -3.400 0.010
oligodendroglioma -2.900 0.007
glioblastoma -4.200 0.000
osteosarcoma -1.624 0.009
medulloblastoma -3.100 0.001
atypical teratoid / rhabdoid tumor -3.700 0.000
medulloblastoma, large-cell -2.900 0.017
primitive neuroectodermal tumor -3.600 0.001
tuberculosis and treatment for 3 months 1.900 0.000
intraductal papillary-mucinous adenoma (... -1.300 0.014
pediatric high grade glioma -3.400 0.000
pilocytic astrocytoma -2.900 0.000
Breast cancer 2.300 0.003
Pick disease -2.000 0.002
ductal carcinoma in situ -1.600 0.005
invasive ductal carcinoma -1.800 0.009
ovarian cancer 1.200 0.043
pituitary cancer 1.300 0.027
sarcoidosis -1.100 0.006

Gene RIF (10)

PMID Text
24692549 these results suggest that betaarrestin1 regulates rasgrf2 gene expression and Rac activation to affect membrane protrusion and cell migration and invasion.
23827383 Case-control studies reveal malignant mesothelioma risk associated with variants in the SDK1, CRTAM and RASGRF2 genes.
23223532 RASGRF2 has a role in the regulation of mesolimbic dopamine neuron activity, reward response, and alcohol use and abuse
21685891 Demonstrate a role for RasGRF1/2 as negative regulators of Cdc42 activation, suppressing tumor cell movement, cytoskeletal dynamics and cell transformation.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20011522 These data reveal unexpected negative roles for Vav1 and RasGRF2 in different stages of T-cell lymphoma progression.
19692568 Farnesylated but not geranylgeranylated TC21 can be activated by RasGRF2 due to its pleckstrin homology 1 domain, by a mechanism independent of localization & of its ability to associate to membranes.
17923690 These results identify RasGRF2 as an additional component of the signaling machinery involved in T-cell receptor- and NF-AT-mediated immune responses.
16596198 Aberrant methylation of RASGRF2 is associated with human non-small cell lung cancer
14749369 RasGRF family exchange factors, both endogenous and ectopically expressed, are present in the endoplasmic reticulum but not in the Golgi complex

AA Sequence

MQKSVRYNEGHALYLAFLARKEGTKRGFLSKKTAEASRWHEKWFALYQNVLFYFEGEQSCRPAGMYLLEG      1 - 70
CSCERTPAPPRAGAGQGGVRDALDKQYYFTVLFGHEGQKPLELRCEEEQDGKEWMEAIHQASYADILIER     71 - 140
EVLMQKYIHLVQIVETEKIAANQLRHQLEDQDTEIERLKSEIIALNKTKERMRPYQSNQEDEDPDIKKIK    141 - 210
KVQSFMRGWLCRRKWKTIVQDYICSPHAESMRKRNQIVFTMVEAESEYVHQLYILVNGFLRPLRMAASSK    211 - 280
KPPISHDDVSSIFLNSETIMFLHEIFHQGLKARIANWPTLILADLFDILLPMLNIYQEFVRNHQYSLQVL    281 - 350
ANCKQNRDFDKLLKQYEANPACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLE    351 - 420
ELSRVMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFIRQGSLIQVPSVERGKLSKVRLGSLSLKKE    421 - 490
GERQCFLFTKHFLICTRSSGGKLHLLKTGGVLSLIDCTLIEEPDASDDDSKGSGQVFGHLDFKIVVEPPD    491 - 560
AAAFTVVLLAPSRQEKAAWMSDISQCVDNIRCNGLMTIVFEENSKVTVPHMIKSDARLHKDDTDICFSKT    561 - 630
LNSCKVPQIRYASVERLLERLTDLRFLSIDFLNTFLHTYRIFTTAAVVLGKLSDIYKRPFTSIPVRSLEL    631 - 700
FFATSQNNRGEHLVDGKSPRLCRKFSSPPPLAVSRTSSPVRARKLSLTSPLNSKIGALDLTTSSSPTTTT    701 - 770
QSPAASPPPHTGQIPLDLSRGLSSPEQSPGTVEENVDNPRVDLCNKLKRSIQKAVLESAPADRAGVESSP    771 - 840
AADTTELSPCRSPSTPRHLRYRQPGGQTADNAHCSVSPASAFAIATAAAGHGSPPGFNNTERTCDKEFII    841 - 910
RRTATNRVLNVLRHWVSKHAQDFELNNELKMNVLNLLEEVLRDPDLLPQERKAAANILRALSQDDQDDIH    911 - 980
LKLEDIIQMTDCMKAECFESLSAMELAEQITLLDHVIFRSIPYEEFLGQGWMKLDKNERTPYIMKTSQHF    981 - 1050
NDMSNLVASQIMNYADVSSRANAIEKWVAVADICRCLHNYNGVLEITSALNRSAIYRLKKTWAKVSKQTK   1051 - 1120
ALMDKLQKTVSSEGRFKNLRETLKNCNPPAVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIR   1121 - 1190
EIRQFQQTSYRIDHQPKVAQYLLDKDLIIDEDTLYELSLKIEPRLPA                          1191 - 1237
//

Text Mined References (33)

PMID Year Title
25335168 2014 Common variants at 1p36 are associated with superior frontal gyrus volume.
24692549 2014 ?Arrestin1 regulates the guanine nucleotide exchange factor RasGRF2 expression and the small GTPase Rac-mediated formation of membrane protrusion and cell motility.
23827383 2013 A genome-wide association study for malignant mesothelioma risk.
23568457 2013 Genetic variants associated with disordered eating.
23223532 2012 RASGRF2 regulates alcohol-induced reinforcement by influencing mesolimbic dopamine neuron activity and dopamine release.
22419666 2012 Genome wide study of maternal and parent-of-origin effects on the etiology of orofacial clefts.
21685891 2011 RasGRF suppresses Cdc42-mediated tumour cell movement, cytoskeletal dynamics and transformation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21130132 2011 Genome-wide association study of blood pressure response to methylphenidate treatment of attention-deficit/hyperactivity disorder.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...