Property Summary

NCBI Gene PubMed Count 71
Grant Count 224
R01 Count 97
Funding $29,022,197.66
PubMed Score 417.73
PubTator Score 67.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.143 0.001
glioblastoma 1.100 0.003
intraductal papillary-mucinous carcinoma... 1.200 0.010
lung cancer 1.200 0.008
Breast cancer 3.000 0.025
group 3 medulloblastoma 1.200 0.014
non primary Sjogren syndrome sicca 1.400 0.014
ovarian cancer 2.900 0.000

Synonym

Accession O14818 B2R515 Q5JXJ2 Q9BR53 Q9H4K5 Q9UEU8
Symbols C6
HSPC
RC6-1
XAPC7
HEL-S-276

Gene

PDB

5GJQ   5GJR   4R3O   4R67   5A0Q   5LE5   5LEX   5LEY   5LEZ   5LF0   5LF1   5LF3   5LF4   5LF6   5LF7  

Gene RIF (39)

PMID Text
26657688 Data indicate that proteasome subunit alpha 6 (PSMA6) direct contacts with proteasome subunit alpha 7 (PSMA7) tetradecamer.
26624926 Studies have found significant associations of the treatment response with the 26S proteasome non-ATPase subunit 9 (PSMD9), proteasome alpha type 7 subunit (PSMA7) and PSMD13 genes.
25620702 c-Abl regulates proteasome abundance by controlling the ubiquitin-proteasomal degradation of PSMA7 subunit
23839082 PSMA7 functions partially through downregulation NOD1.
22584585 PSMA7 inhibits the proliferation, tumorigenicity and invasion of A549 cells in vitro
21256111 CNB binds to proteasome subunit alpha type 7 (PSMA7) and inhibits the transactivation activity of hypoxia-inducible factor-1alpha (HIF-1alpha) via the proteasome pathway.
19362550 cell surface binding of EMAP-II results in its internalization into the cytoplasmic compartment where it interacts with PSMA7, a component of the proteasome degradation pathway. This interaction increases HIF-1alpha degradation under hypoxic conditions.
19062718 High expression of PSMA7 was significantly correlated with liver metastasis.
18854154 Knockdown of proteasome (prosome, macropain) subunit, alpha type, 7 (PSMA7) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18202793 PSMA7 may play an important role in colorectal cancer progression.
More...

AA Sequence

MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVRKICALDDNVC      1 - 70
MAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDFDG     71 - 140
TPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDEAIETDDLTIKLVIKALLEVVQSGGKNIELAV    141 - 210
MRRDQSLKILNPEEIEKYVAEIEKEKEENEKKKQKKAS                                    211 - 248
//

Text Mined References (79)

PMID Year Title
26657688 2015 Disassembly of the self-assembled, double-ring structure of proteasome ?7 homo-tetradecamer by ?6.
26624926 2015 Proteasome system dysregulation and treatment resistance mechanisms in major depressive disorder.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25620702 2015 c-Abl regulates proteasome abundance by controlling the ubiquitin-proteasomal degradation of PSMA7 subunit.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23839082 2013 PSMA7 directly interacts with NOD1 and regulates its function.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22584585 2012 PSMA7 inhibits the tumorigenicity of A549 human lung adenocarcinoma cells.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
More...