Property Summary

NCBI Gene PubMed Count 74
PubMed Score 496.73
PubTator Score 67.77

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
Breast cancer 3.000 2.5e-02
glioblastoma 1.100 3.2e-03
group 3 medulloblastoma 1.200 1.4e-02
intraductal papillary-mucinous carcinoma... 1.200 1.0e-02
lung cancer 1.200 8.2e-03
Multiple myeloma 1.143 1.0e-03
non primary Sjogren syndrome sicca 1.400 1.4e-02
ovarian cancer 2.000 2.3e-05

Gene RIF (37)

AA Sequence

MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVRKICALDDNVC      1 - 70
MAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDFDG     71 - 140
TPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDEAIETDDLTIKLVIKALLEVVQSGGKNIELAV    141 - 210
MRRDQSLKILNPEEIEKYVAEIEKEKEENEKKKQKKAS                                    211 - 248
//

Text Mined References (91)

PMID Year Title