Property Summary

NCBI Gene PubMed Count 16
PubMed Score 88.97
PubTator Score 14.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 8.02595716498705E-26
non-small cell lung cancer 2798 3.23142362660687E-17
ovarian cancer 8492 1.20036685494116E-11
ependymoma 2514 9.12028359065241E-6
nephrosclerosis 329 2.42275559001794E-5
pilocytic astrocytoma 3086 4.99739659094203E-5
group 3 medulloblastoma 2254 5.81065877484642E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 1.06851608023684E-4
ductal carcinoma in situ 1745 2.59287427048882E-4
atypical teratoid / rhabdoid tumor 4369 4.30626538510537E-4
pediatric high grade glioma 2712 5.15205476902758E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00144628067546722
psoriasis 6685 0.00257515656274944
glioblastoma 5572 0.0030524858098194
primary pancreatic ductal adenocarcinoma 1271 0.00477116534658038
invasive ductal carcinoma 2950 0.00632539383803304
fibroadenoma 557 0.0133138044374199
primitive neuroectodermal tumor 3031 0.0446175486071033

Expression

Synonym

Accession O14817 Q6IAP6 Tspan-4
Symbols NAG2
NAG-2
TM4SF7
TSPAN-4
TETRASPAN

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (3)

PMID Text
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of tetraspanin 4 (TSPAN4) in peptide-treated PBMCs
22236579 TM4SF4/il-TMP has the potential to be biomarker in a hepatocellular carcinoma and plays a crucial role in promotion of cancer cell proliferation
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MARACLQAVKYLMFAFNLLFWLGGCGVLGVGIWLAATQGSFATLSSSFPSLSAANLLIITGAFVMAIGFV      1 - 70
GCLGAIKENKCLLLTFFLLLLLVFLLEATIAILFFAYTDKIDRYAQQDLKKGLHLYGTQGNVGLTNAWSI     71 - 140
IQTDFRCCGVSNYTDWFEVYNATRVPDSCCLEFSESCGLHAPGTWWKAPCYETVKVWLQENLLAVGIFGL    141 - 210
CTALVQILGLTFAMTMYCQVVKADTYCA                                              211 - 238
//

Text Mined References (18)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22236579 2012 Human tetraspanin transmembrane 4 superfamily member 4 or intestinal and liver tetraspan membrane protein is overexpressed in hepatocellular carcinoma and accelerates tumor cell growth.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14671302 2003 Inferring nonneutral evolution from human-chimp-mouse orthologous gene trios.
More...