Property Summary

NCBI Gene PubMed Count 16
PubMed Score 93.18
PubTator Score 14.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Astrocytoma, Pilocytic 1.400 5.6e-05
atypical teratoid / rhabdoid tumor 1.200 1.9e-02
ductal carcinoma in situ -1.100 5.6e-04
ependymoma 1.700 9.1e-06
fibroadenoma -1.200 1.3e-02
glioblastoma 1.300 3.1e-03
group 3 medulloblastoma 1.800 5.1e-04
intraductal papillary-mucinous adenoma (... -1.200 1.1e-04
intraductal papillary-mucinous carcinoma... -1.200 1.4e-03
invasive ductal carcinoma -1.300 1.9e-03
lung carcinoma -1.400 8.0e-26
nephrosclerosis 1.040 2.4e-05
non-small cell lung cancer -1.520 4.1e-21
ovarian cancer -1.900 1.2e-11
pediatric high grade glioma 1.200 5.2e-04
primary pancreatic ductal adenocarcinoma 1.165 4.8e-03
primitive neuroectodermal tumor 1.400 4.5e-02
psoriasis -1.100 2.6e-03

Synonym

Accession O14817 Q6IAP6 Tspan-4
Symbols NAG2
NAG-2
TM4SF7
TSPAN-4
TETRASPAN

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

AA Sequence

MARACLQAVKYLMFAFNLLFWLGGCGVLGVGIWLAATQGSFATLSSSFPSLSAANLLIITGAFVMAIGFV      1 - 70
GCLGAIKENKCLLLTFFLLLLLVFLLEATIAILFFAYTDKIDRYAQQDLKKGLHLYGTQGNVGLTNAWSI     71 - 140
IQTDFRCCGVSNYTDWFEVYNATRVPDSCCLEFSESCGLHAPGTWWKAPCYETVKVWLQENLLAVGIFGL    141 - 210
CTALVQILGLTFAMTMYCQVVKADTYCA                                              211 - 238
//

Text Mined References (18)

PMID Year Title