Property Summary

NCBI Gene PubMed Count 12
PubMed Score 16.10
PubTator Score 9.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Breast cancer 1.200 1.9e-05
colon cancer -1.400 1.8e-02
intraductal papillary-mucinous adenoma (... 5.400 1.5e-05
intraductal papillary-mucinous carcinoma... 4.200 7.1e-04
intraductal papillary-mucinous neoplasm ... 2.700 3.5e-02
ovarian cancer 1.200 1.2e-06
pancreatic cancer 1.300 1.7e-03
psoriasis -1.100 2.3e-08

Gene RIF (6)

AA Sequence

MPYLYRAPGPQAHPVPKDARITHSSGQSFEQMRQECLQRGTLFEDADFPASNSSLFYSERPQIPFVWKRP      1 - 70
GEIVKNPEFILGGATRTDICQGELGDCWLLAAIASLTLNQKALARVIPQDQSFGPGYAGIFHFQFWQHSE     71 - 140
WLDVVIDDRLPTFRDRLVFLHSADHNEFWSALLEKAYAKLNGSYEALKGGSAIEAMEDFTGGVAETFQTK    141 - 210
EAPENFYEILEKALKRGSLLGCFIDTRSAAESEARTPFGLIKGHAYSVTGIDQVSFRGQRIELIRIRNPW    211 - 280
GQVEWNGSWSDSSPEWRSVGPAEQKRLCHTALDDGEFWMAFKDFKAHFDKVEICNLTPDALEEDAIHKWE    281 - 350
VTVHQGSWVRGSTAGGCRNFLDTFWTNPQIKLSLTEKDEGQEECSFLVALMQKDRRKLKRFGANVLTIGY    351 - 420
AIYECPDKDEHLNKDFFRYHASRARSKTFINLREVSDRFKLPPGEYILIPSTFEPHQEADFCLRIFSEKK    421 - 490
AITRDMDGNVDIDLPEPPKPTPPDQETEEEQRFRALFEQVAGEDMEVTAEELEYVLNAVLQKKKDIKFKK    491 - 560
LSLISCKNIISLMDTSGNGKLEFDEFKVFWDKLKQWINLFLRFDADKSGTMSTYELRTALKAAGFQLSSH    561 - 630
LLQLIVLRYADEELQLDFDDFLNCLVRLENASRVFQALSTKNKEFIHLNINEFIHLTMNI              631 - 690
//

Text Mined References (13)

PMID Year Title