Property Summary

NCBI Gene PubMed Count 12
PubMed Score 15.46
PubTator Score 9.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Gene RIF (6)

PMID Text
25539577 calpain-9 may play a role in breast cancer and that low expression is associated with poorer patient clinical outcome following endocrine therapy.
20453000 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19074885 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of calpain 9 (CAPN9) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
17157313 We have solved the structures of human calpain 1 and calpain 9 protease cores ; both structures have clear implications for the function of non-catalytic domains of full-length calpains in the calcium-mediated activation of the enzyme.

AA Sequence

MPYLYRAPGPQAHPVPKDARITHSSGQSFEQMRQECLQRGTLFEDADFPASNSSLFYSERPQIPFVWKRP      1 - 70
GEIVKNPEFILGGATRTDICQGELGDCWLLAAIASLTLNQKALARVIPQDQSFGPGYAGIFHFQFWQHSE     71 - 140
WLDVVIDDRLPTFRDRLVFLHSADHNEFWSALLEKAYAKLNGSYEALKGGSAIEAMEDFTGGVAETFQTK    141 - 210
EAPENFYEILEKALKRGSLLGCFIDTRSAAESEARTPFGLIKGHAYSVTGIDQVSFRGQRIELIRIRNPW    211 - 280
GQVEWNGSWSDSSPEWRSVGPAEQKRLCHTALDDGEFWMAFKDFKAHFDKVEICNLTPDALEEDAIHKWE    281 - 350
VTVHQGSWVRGSTAGGCRNFLDTFWTNPQIKLSLTEKDEGQEECSFLVALMQKDRRKLKRFGANVLTIGY    351 - 420
AIYECPDKDEHLNKDFFRYHASRARSKTFINLREVSDRFKLPPGEYILIPSTFEPHQEADFCLRIFSEKK    421 - 490
AITRDMDGNVDIDLPEPPKPTPPDQETEEEQRFRALFEQVAGEDMEVTAEELEYVLNAVLQKKKDIKFKK    491 - 560
LSLISCKNIISLMDTSGNGKLEFDEFKVFWDKLKQWINLFLRFDADKSGTMSTYELRTALKAAGFQLSSH    561 - 630
LLQLIVLRYADEELQLDFDDFLNCLVRLENASRVFQALSTKNKEFIHLNINEFIHLTMNI              631 - 690
//

Text Mined References (13)

PMID Year Title
25539577 2014 Low calpain-9 is associated with adverse disease-specific survival following endocrine therapy in breast cancer.
23049088 2012 A genome-wide association study provides evidence for association of chromosome 8p23 (MYP10) and 10q21.1 (MYP15) with high myopia in the French Population.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
17157313 2007 The crystal structures of human calpains 1 and 9 imply diverse mechanisms of action and auto-inhibition.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11516996 2001 The calpain family and human disease.
10835488 2000 Isolation of two novel genes, down-regulated in gastric cancer.
More...