Property Summary

NCBI Gene PubMed Count 32
PubMed Score 58.65
PubTator Score 50.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
breast carcinoma 1.400 4.9e-02
osteosarcoma 1.205 1.1e-04
psoriasis 1.100 1.3e-03

 GO Component (1)

Gene RIF (19)

AA Sequence

MDYSYLNSYDSCVAAMEASAYGDFGACSQPGGFQYSPLRPAFPAAGPPCPALGSSNCALGALRDHQPAPY      1 - 70
SAVPYKFFPEPSGLHEKRKQRRIRTTFTSAQLKELERVFAETHYPDIYTREELALKIDLTEARVQVWFQN     71 - 140
RRAKFRKQERAASAKGAAGAAGAKKGEARCSSEDDDSKESTCSPTPDSTASLPPPPAPGLASPRLSPSPL    141 - 210
PVALGSGPGPGPGPQPLKGALWAGVAGGGGGGPGAGAAELLKAWQPAESGPGPFSGVLSSFHRKPGPALK    211 - 280
TNLF                                                                      281 - 284
//

Text Mined References (32)

PMID Year Title