Property Summary

NCBI Gene PubMed Count 26
Grant Count 36
R01 Count 22
Funding $4,245,599.87
PubMed Score 76.06
PubTator Score 26.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytoma -2.300 0.000
posterior fossa group B ependymoma -5.400 0.000
glioblastoma -4.000 0.000
oligodendroglioma -2.000 0.000
group 3 medulloblastoma -3.900 0.000
atypical teratoid/rhabdoid tumor -4.900 0.000
medulloblastoma, large-cell -2.500 0.000
primitive neuroectodermal tumor -3.400 0.000
interstitial cystitis 1.100 0.001
pediatric high grade glioma -4.000 0.000
pilocytic astrocytoma -4.900 0.000
Pick disease -1.800 0.009

Gene RIF (12)

PMID Text
26603934 Collectively these results demonstrate that CPX-1 is a secreted collagen-binding glycoprotein and provide a foundation for future studies investigating the function of CPX-1.
26245303 Studies indicate the role of the small regulatory factor complexin in Ca(2+)-dependent vesicle fusion and exocytosis.
25831964 Data support the the trans insertion model for complexin clamping.
22705946 Together with synaptotagmin 1, complexin synchronizes and stimulates rapid fusion of accumulated docked vesicles in response to physiological Ca(2+) concentrations.
21785414 The 'central helix' of complexin is anchored to one SNARE complex, while its 'accessory helix' extends away at ~45 degrees and bridges to a second complex, occupying the vacant v-SNARE binding site to inhibit fusion.
21785412 The crystal structure of complexin bound to a prefusion SNAREpin mimetic shows that the accessory helix extends away from the SNAREpin in an 'open' conformation, binding another SNAREpin and inhibiting its assembly, to clamp fusion.
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18240322 CX1 level increased progressively across development
16794037 description of what may represent a basic principle of the coupling mechanism in SNARE dependent exocytosis: a reversible clamping protein, complexin, that can freeze the SNAREpin, an assembled fusion-competent intermediate en route to fusion
16442780 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MEFVMKQALGGATKDMGKMLGGDEEKDPDAAKKEEERQEALRQAEEERKAKYAKMEAEREAVRQGIRDKY      1 - 70
GIKKKEEREAEAQAAMEANSEGSLTRPKKAIPPGCGDEVEEEDESILDTVIKYLPGPLQDMLKK           71 - 134
//

Text Mined References (27)

PMID Year Title
26603934 2015 Carboxypeptidase X-1 (CPX-1) is a secreted collagen-binding glycoprotein.
26245303 2015 Complexins: small but capable.
25831964 2015 Re-visiting the trans insertion model for complexin clamping.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
22705946 2012 Complexin arrests a pool of docked vesicles for fast Ca2+-dependent release.
21785414 2011 Complexin cross-links prefusion SNAREs into a zigzag array.
21785412 2011 A conformational switch in complexin is required for synaptotagmin to trigger synaptic fusion.
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
18240322 2008 Regulation of complexin 1 and complexin 2 in the developing human prefrontal cortex.
More...