Property Summary

NCBI Gene PubMed Count 29
Grant Count 28
R01 Count 17
Funding $19,310,158.06
PubMed Score 278.17
PubTator Score 22.53

Knowledge Summary

Patent

No data available

Expression

Gene RIF (9)

PMID Text
25973078 The association of the MARS rs6782181 polymorphism and serum lipid levels is different between the Mulao and Han populations, or between males and females in the both ethnic groups.
25800439 The MRAS gene loci might have a minor effect in conferring susceptibility to coronary artery disease in the Chinese population.
24211266 Both MRAS and SHOC2 play a key role in polarized migration.
20971364 Observational study of gene-disease association. (HuGE Navigator)
20738937 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19198612 Identification of one new CAD risk locus on 3q22.3 in MRAS, and suggestive association with a locus on 12q24.31 near HNF1A-C12orf43.
18628988 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17538012 These findings proved a crucial role of the cross-talk between two Ras-family GTPases M-Ras and Rap1, mediated by RA-GEF-2, in adhesion signaling.
12138204 implicated in a novel pathway of neuronal differentiation by coupling specific trophic factors to the MAPK cascade through the activation of B-Raf

AA Sequence

MATSAVPSDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDNQWAILDVLDTAG      1 - 70
QEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFPMILVANKVDLMHLRKITREQ     71 - 140
GKEMATKHNIPYIETSAKDPPLNVDKAFHDLVRVIRQQIPEKSQKKKKKTKWRGDRATGTHKLQCVIL      141 - 208
//

Text Mined References (30)

PMID Year Title
25973078 2015 Association between the MARS rs6782181 polymorphism and serum lipid levels.
25800439 2015 Genetic insight into the role of MRAS in coronary artery disease risk.
25137548 2014 A Novel SHOC2 Variant in Rasopathy.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
24262325 2014 Shared genetic susceptibility to ischemic stroke and coronary artery disease: a genome-wide analysis of common variants.
24211266 2013 An MRAS, SHOC2, and SCRIB complex coordinates ERK pathway activation with polarity and tumorigenic growth.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21378990 2011 Large-scale association analysis identifies 13 new susceptibility loci for coronary artery disease.
20971364 2010 A multilocus genetic risk score for coronary heart disease: case-control and prospective cohort analyses.
More...