Property Summary

NCBI Gene PubMed Count 30
PubMed Score 309.92
PubTator Score 22.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Protein-protein Interaction (1)

Gene RIF (10)

AA Sequence

MATSAVPSDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDNQWAILDVLDTAG      1 - 70
QEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFPMILVANKVDLMHLRKITREQ     71 - 140
GKEMATKHNIPYIETSAKDPPLNVDKAFHDLVRVIRQQIPEKSQKKKKKTKWRGDRATGTHKLQCVIL      141 - 208
//

Text Mined References (31)

PMID Year Title