Property Summary

NCBI Gene PubMed Count 10
Grant Count 34
R01 Count 29
Funding $5,738,268.26
PubMed Score 131.45
PubTator Score 41.42

Knowledge Summary

Patent (10,169)

TINX Plot

  Disease Relevance (2)

Gene RIF (3)

PMID Text
25706283 The murine and human TAAR5 (hTAAR5) display significant basal activity in the Gq/11 pathway.
23393561 Human trace amine-associated receptor TAAR5 can be activated by trimethylamine.
16878137 Previous studies reported TAAR expression in brain. This paper found TAAR expression only in olfactory epithelial cells and that each TAAR detects a unique set of amine ligands. TAARs seem to function as a family of chemosensory receptors for amines.

AA Sequence

MRAVFIQGAEEHPAAFCYQVNGSCPRTVHTLGIQLVIYLACAAGMLIIVLGNVFVAFAVSYFKALHTPTN      1 - 70
FLLLSLALADMFLGLLVLPLSTIRSVESCWFFGDFLCRLHTYLDTLFCLTSIFHLCFISIDRHCAICDPL     71 - 140
LYPSKFTVRVALRYILAGWGVPAAYTSLFLYTDVVETRLSQWLEEMPCVGSCQLLLNKFWGWLNFPLFFV    141 - 210
PCLIMISLYVKIFVVATRQAQQITTLSKSLAGAAKHERKAAKTLGIAVGIYLLCWLPFTIDTMVDSLLHF    211 - 280
ITPPLVFDIFIWFAYFNSACNPIIYVFSYQWFRKALKLTLSQKVFSPQTRTVDLYQE                 281 - 337
//

Text Mined References (10)

PMID Year Title
25706283 2015 Inverse agonistic action of 3-iodothyronamine at the human trace amine-associated receptor 5.
23393561 2013 Human trace amine-associated receptor TAAR5 can be activated by trimethylamine.
20559446 2010 Structural and functional evolution of the trace amine-associated receptors TAAR3, TAAR4 and TAAR5 in primates.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
16878137 2006 A second class of chemosensory receptors in the olfactory epithelium.
15718104 2005 Trace amine-associated receptors form structurally and functionally distinct subfamilies of novel G protein-coupled receptors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9464258 1998 Cloning of a putative human neurotransmitter receptor expressed in skeletal muscle and brain.