Property Summary

NCBI Gene PubMed Count 62
Grant Count 37
R01 Count 7
Funding $4,022,422.12
PubMed Score 380.95
PubTator Score 87.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
pancreatic cancer 1.300 0.002
osteosarcoma -3.215 0.001
juvenile dermatomyositis -1.251 0.000
tuberculosis 1.900 0.000
non-small cell lung cancer -1.438 0.000
lung cancer -2.100 0.010
adult high grade glioma -1.200 0.001
group 4 medulloblastoma -1.100 0.001
pancreatic carcinoma 1.300 0.002
subependymal giant cell astrocytoma 1.430 0.006
axial spondyloarthropathy 1.100 0.015

Gene RIF (39)

PMID Text
26542757 Results identified epigenetic inactivation of TNFRSF10C and TNFRSF10D in majority of cervical cancer cases.
26050621 DcRs regulate TRAIL sensitivity at a supracellular level
25808868 DcR1 upregulation mediates temozolomide resistance.
24649804 membrane expression more common in endometrioid endometrial cancer than in normal endometrium
24534820 DcR1 levels in serum sample which were significantly lower in AMD patients.
24211571 the results presented here claim for a relevant impact of aberrant methylation of decoy receptors in melanoma and allow to understand how the silencing of DcR1 and DcR2 is related to melanomagenesis.
23584885 The membrane expression of the TRAIL receptors DR4, DR5, DcR1 and DcR2 is greater in normal endometrium than endometrioid adenocarcinoma (EAC). The level of the receptors in EAC is not dependent on grading and staging and does not predict survival.
23320456 GATA4 and DcR1 promoter hypermethylation is tumor specific event in glioblastoma but they promoter methylation cannot be considered as a prognostic marker of glioblastoma survival.
22555108 Primary EOC is associated to a lower TRAIL-R3 expression.
21483669 HIV-1 Env-pseudotyped virus-infected monocyte-derived macrophage cells downregulate expression of TRAIL decoy receptors DcR1 and DcR2, and cellular FLICE-inhibitory protein (c-FLIP)
More...

AA Sequence

MARIPKTLKFVVVIVAVLLPVLAYSATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCT      1 - 70
EGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSN     71 - 140
CTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAE    141 - 210
ETMTTSPGTPAPAAEETMITSPGTPASSHYLSCTIVGIIVLIVLLIVFV                         211 - 259
//

Text Mined References (63)

PMID Year Title
26542757 2016 Epigenetic inactivation of TRAIL decoy receptors at 8p12-21.3 commonly deleted region confers sensitivity to Apo2L/trail-Cisplatin combination therapy in cervical cancer.
26050621 2016 Decoy receptors block TRAIL sensitivity at a supracellular level: the role of stromal cells in controlling tumour TRAIL sensitivity.
25808868 2015 Decoy Receptor DcR1 Is Induced in a p50/Bcl3-Dependent Manner and Attenuates the Efficacy of Temozolomide.
24649804 2014 Membrane expression of trail receptors DcR1 and DcR2 in the normal endometrium, endometrial atypical hyperplasia and endometrioid endometrial cancer.
24534820 2014 Does DcR1 (TNF-related apoptosis-inducing-ligand Receptor 3) have any role in human AMD pathogenesis?
24211571 2013 Impact of DNA methyltransferases on the epigenetic regulation of tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) receptor expression in malignant melanoma.
23584885 2013 Membrane expression of TRAIL receptors DR4, DR5, DcR1 and DcR2 in the normal endometrium, atypical endometrial hyperplasia and endometrioid adenocarcinoma: a tissue microarray study.
23320456 2013 GATA4 and DcR1 methylation in glioblastomas.
22555108 2012 TRAIL-R3-related apoptosis: epigenetic and expression analyses in women with ovarian neoplasia.
21281967 2011 High TRAIL-R3 expression on leukemic blasts is associated with poor outcome and induces apoptosis-resistance which can be overcome by targeting TRAIL-R2.
More...