Property Summary

NCBI Gene PubMed Count 63
PubMed Score 407.69
PubTator Score 87.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.200 1.2e-03
axial spondyloarthropathy 1.100 1.5e-02
group 4 medulloblastoma -1.100 8.1e-04
juvenile dermatomyositis -1.251 3.0e-11
lung cancer -2.100 1.0e-02
non-small cell lung cancer -1.438 4.1e-12
osteosarcoma -2.185 2.4e-03
pancreatic cancer 1.300 2.0e-03
pancreatic carcinoma 1.300 2.0e-03
subependymal giant cell astrocytoma 1.136 4.2e-02
tuberculosis 1.900 5.8e-05

Gene RIF (40)

AA Sequence

MARIPKTLKFVVVIVAVLLPVLAYSATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCT      1 - 70
EGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSN     71 - 140
CTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAE    141 - 210
ETMTTSPGTPAPAAEETMITSPGTPASSHYLSCTIVGIIVLIVLLIVFV                         211 - 259
//

Text Mined References (64)

PMID Year Title