Property Summary

NCBI Gene PubMed Count 22
PubMed Score 48.19
PubTator Score 24.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
lung adenocarcinoma -1.500 2.9e-12
lung carcinoma -1.200 2.8e-08
pancreatic cancer -1.700 6.4e-03
pancreatic carcinoma -1.700 6.4e-03
Rhinitis 1.300 1.2e-02
rhinitis with controlled asthma 1.400 2.1e-03
tuberculosis -1.200 1.1e-02

Gene RIF (4)

AA Sequence

MDLPYYHGRLTKQDCETLLLKEGVDGNFLLRDSESIPGVLCLCVSFKNIVYTYRIFREKHGYYRIQTAEG      1 - 70
SPKQVFPSLKELISKFEKPNQGMVVHLLKPIKRTSPSLRWRGLKLELETFVNSNSDYVDVLP             71 - 132
//

Text Mined References (23)

PMID Year Title