Property Summary

NCBI Gene PubMed Count 20
Grant Count 39
R01 Count 19
Funding $4,415,977.26
PubMed Score 48.26
PubTator Score 24.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
pancreatic cancer -1.700 0.006
rhinitis with controlled asthma 1.400 0.002
uncontrolled asthma 1.900 0.004
tuberculosis and treatment for 6 months -1.800 0.001
lung adenocarcinoma -1.600 0.000
pancreatic carcinoma -1.700 0.006
lung carcinoma -1.200 0.000

Gene RIF (3)

PMID Text
24687958 EAT-2 mediates its effects in natural killer cells by linking SLAM family receptors to phospholipase Cgamma, calcium fluxes, and Erk kinase.
24374770 Data indicate that Ewing's sarcoma-associated transcript-2 (EAT-2) over-expression increased the anti-tumor activity of NK cells against K562 tumor cell. targets.
16920955 NTB-A-mediated IFN-gamma production was greatly reduced in the absence of SLAM-associated protein (SAP), demonstrating that cytokine production and cytotoxicity are differentially dependent on SAP and possibly EAT-2

AA Sequence

MDLPYYHGRLTKQDCETLLLKEGVDGNFLLRDSESIPGVLCLCVSFKNIVYTYRIFREKHGYYRIQTAEG      1 - 70
SPKQVFPSLKELISKFEKPNQGMVVHLLKPIKRTSPSLRWRGLKLELETFVNSNSDYVDVLP             71 - 132
//

Text Mined References (21)

PMID Year Title
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25416956 2014 A proteome-scale map of the human interactome network.
24952745 2014 Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
24687958 2014 EAT-2, a SAP-like adaptor, controls NK cell activation through phospholipase C?, Ca++, and Erk, leading to granule polarization.
24642916 2014 Fine specificity and molecular competition in SLAM family receptor signalling.
24374770 2014 Manipulation of EAT-2 expression promotes induction of multiple beneficial regulatory and effector functions of the human innate immune system as a novel immunomodulatory strategy.
23322602 2013 Deciphering of ADP-induced, phosphotyrosine-dependent signaling networks in human platelets by Src-homology 2 region (SH2)-profiling.
21219180 2011 SLAM family receptors and SAP adaptors in immunity.
16920955 2006 Molecular analysis of NTB-A signaling: a role for EAT-2 in NTB-A-mediated activation of human NK cells.
More...