Property Summary

NCBI Gene PubMed Count 151
PubMed Score 1338.82
PubTator Score 335.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytoma 1.400 1.8e-06
ependymoma 1.300 6.4e-03
oligodendroglioma 1.100 4.7e-04
pediatric high grade glioma 1.600 4.8e-02
psoriasis -1.500 7.7e-19

Gene RIF (132)

AA Sequence

MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAP      1 - 70
NISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFF     71 - 140
KFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKT    141 - 210
VLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESR    211 - 280
CCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINM    281 - 350
LYFNGKEQIIYGKIPAMVVDRCGCS                                                 351 - 375
//

Text Mined References (151)

PMID Year Title