Property Summary

NCBI Gene PubMed Count 135
Grant Count 361
R01 Count 164
Funding $48,998,126.95
PubMed Score 1218.38
PubTator Score 335.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytoma 1.400 0.000
oligodendroglioma 1.100 0.000
posterior fossa group B ependymoma 1.400 0.002
pediatric high grade glioma 1.600 0.048
psoriasis -1.500 0.000

Synonym

Accession O14793 A1C2J7 A1C2K0 Q6B0H2 GDF-8
Symbols GDF8
MSLHP

Gene

PANTHER Protein Class (2)

Gene RIF (117)

PMID Text
27034275 Myostatin is a well-described negative regulator of postnatal skeletal and cardiac muscle mass and modulates metabolic processes. It functions in the heart, skeletal muscle, and brain. Review.
26998756 Plasma myostatin levels are increased in chronic obstructive pulmonary disease patients who have cor pulmonale.
26607022 In human granulosa cells, GDF8 may play an important role in the modulation of cellular responsiveness to gonadotropins and in the regulation of ovarian steroid production, most likely as a luteinization inhibitor.
26577677 Findings suggest that GDF8 and CTGF may play critical roles in the regulation of proliferative events in human granulosa cells.
26502079 Plasma MSTN level was elevated in an early stage of CKD, which could be involved in the progression of sarcopenia.
26393401 Plasma myostatin might be suitable in predicting weight regain after marked weight loss, but no association with weight loss was observed in patients undergoing a non-surgical weight loss program.
26305594 it is becoming clearer that besides its conventional role in muscle, myostatin plays a critical role in metabolism. Hence, molecular mechanisms by which myostatin regulates several key metabolic processes need to be further explored.
26086422 Adenomyotic tissues express high levels of myostatin, follistatin, and activin type II receptors.
26046327 The aim of this study was to investigate MSTN polymorphisms in an elderly sarcopenic population in Turkey and determine how they relate to sarcopenia.
25936293 In contrast to elite endurance and power track and field athletes, the MSTN 153RR genotype was not found in short distance-swimmers, and among the long distance-swimmers it was not associated with top level swimming performance.
More...

AA Sequence

MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAP      1 - 70
NISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFF     71 - 140
KFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKT    141 - 210
VLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESR    211 - 280
CCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINM    281 - 350
LYFNGKEQIIYGKIPAMVVDRCGCS                                                 351 - 375
//

Text Mined References (135)

PMID Year Title
27034275 2016 Biochemistry and Biology of GDF11 and Myostatin: Similarities, Differences, and Questions for Future Investigation.
26998756 2016 Higher Plasma Myostatin Levels in Cor Pulmonale Secondary to Chronic Obstructive Pulmonary Disease.
26607022 2016 Effects of growth differentiation factor 8 on steroidogenesis in human granulosa-lutein cells.
26577677 2016 Growth differentiation factor 8 suppresses cell proliferation by up-regulating CTGF expression in human granulosa cells.
26502079 2015 Relationship between Blood Myostatin Levels and Kidney Function:Shimane CoHRE Study.
26393401 2015 Plasma myostatin is only a weak predictor for weight maintenance in obese adults.
26305594 2015 Myostatin: expanding horizons.
26086422 2015 Myostatin, follistatin and activin type II receptors are highly expressed in adenomyosis.
26046327 2015 Myostatin Gene Polymorphism in an Elderly Sarcopenic Turkish Population.
25936293 2015 Frequency of the MSTN Lys(K)-153Arg(R) polymorphism among track & field athletes and swimmers.
More...