Property Summary

NCBI Gene PubMed Count 122
Grant Count 110
R01 Count 56
Funding $20,813,547.4
PubMed Score 298.77
PubTator Score 53.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
Barrett's esophagus 1.100 0.048
esophageal adenocarcinoma 1.500 0.025
psoriasis 2.600 0.000
cutaneous lupus erythematosus 1.900 0.005
osteosarcoma -1.133 0.007
tuberculosis 1.200 0.000
primary pancreatic ductal adenocarcinoma 1.382 0.011
lung cancer -1.800 0.000
active Crohn's disease 2.150 0.006
active ulcerative colitis 2.517 0.010
pancreatic cancer 1.400 0.009
diabetes mellitus -1.100 0.028
lung carcinoma -1.800 0.000
ovarian cancer 1.400 0.001

Synonym

Accession O14791 A5PLQ4 B4DU12 E9PF24 O60804 Q5R3P7 Q5R3P8 Q96AB8 Q96PM4 Q9BQ03
Symbols APOL
APO-L
FSGS4
APOL-I

Gene

Gene RIF (123)

PMID Text
27054572 APOL1 G1 and G2 genotypes in deceased African American liver donors have minimal effects on liver transplant outcomes.
26699492 Expression of either G1 or G2 APOL1 variants increased cell swelling and death vs G0-expressing cells. This was preceded by G1 or G2 APOL1-induced net efflux of intracellular potassium, resulting in the activation of stress-activated protein kinases.
26634651 APOL1 genotype is associated with albuminuria, subclinical atherosclerosis, incident myocardial infarction, and mortality in older African Americans.
26586272 We examined whether APOL1 G1 and G2 renal-risk variant serum concentrations or lipoprotein distributions differed from nonrisk G0 APOL1 in African Americans without nephropathy.
26566060 Shorter renal allograft survival is reproducibly observed after deceased donor kidney transplantation from APOL1 2-renal-risk-variant African American donors.
26430087 Sociodemographic factors and common risk factors for chronic kidney disease progression do not seem to alter APOL1-related CKD progression.
26307671 Trypanolysis by APOL1 is linked to apoptosis-like mitochondrial membrane permabilization occurring together with TbKIFC1-mediated transport of APOL1 from endolysosomal membranes to the mitochondrion.
26180129 blacks with two APOL1 risk alleles had the highest risk for albuminuria and eGFRcys decline in young adulthood, whereas disparities between low-risk blacks and whites were related to differences in traditional risk factors.
26150607 we have shown that individuals with the high risk APOL1 genotype enrolled in the NEPTUNE study present, from a clinical and histologic perspective, with more advanced disease and have less remission of proteinuria over time.
26147622 concordant with the genetic interaction observed in sickle cell disease patients, APOL1 G2 reduces myh9 expression in vivo, suggesting a possible interaction between the altered APOL1 and myh9.
More...

AA Sequence

MEGAALLRVSVLCIWMSALFLGVGVRAEEAGARVQQNVPSGTDTGDPQSKPLGDWAAGTMDPESSIFIED      1 - 70
AIKYFKEKVSTQNLLLLLTDNEAWNGFVAAAELPRNEADELRKALDNLARQMIMKDKNWHDKGQQYRNWF     71 - 140
LKEFPRLKSELEDNIRRLRALADGVQKVHKGTTIANVVSGSLSISSGILTLVGMGLAPFTEGGSLVLLEP    141 - 210
GMELGITAALTGITSSTMDYGKKWWTQAQAHDLVIKSLDKLKEVREFLGENISNFLSLAGNTYQLTRGIG    211 - 280
KDIRALRRARANLQSVPHASASRPRVTEPISAESGEQVERVNEPSILEMSRGVKLTDVAPVSFFLVLDVV    281 - 350
YLVYESKHLHEGAKSETAEELKKVAQELEEKLNILNNNYKILQADQEL                          351 - 398
//

Text Mined References (126)

PMID Year Title
27054572 2016 Deceased-Donor Apolipoprotein L1 Renal-Risk Variants Have Minimal Effects on Liver Transplant Outcomes.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26699492 2016 APOL1 kidney disease risk variants cause cytotoxicity by depleting cellular potassium and inducing stress-activated protein kinases.
26634651 2016 APOL1 Genotype, Kidney and Cardiovascular Disease, and Death in Older Adults.
26586272 2016 Characterization of circulating APOL1 protein complexes in African Americans.
26566060 2016 APOL1 Genotype and Kidney Transplantation Outcomes From Deceased African American Donors.
26430087 2015 Examination of Potential Modifiers of the Association of APOL1 Alleles with CKD Progression.
26307671 2015 Coupling of lysosomal and mitochondrial membrane permeabilization in trypanolysis by APOL1.
26180129 2016 APOL1 Genotype and Race Differences in Incident Albuminuria and Renal Function Decline.
26150607 2016 Integrative Genomics Identifies Novel Associations with APOL1 Risk Genotypes in Black NEPTUNE Subjects.
More...