Property Summary

NCBI Gene PubMed Count 150
PubMed Score 361.19
PubTator Score 53.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
active Crohn's disease 2.150 6.0e-03
active ulcerative colitis 2.517 1.0e-02
Barrett's esophagus 1.100 4.8e-02
cutaneous lupus erythematosus 1.900 5.0e-03
diabetes mellitus -1.100 2.8e-02
esophageal adenocarcinoma 1.500 2.5e-02
lung cancer -1.800 2.5e-05
lung carcinoma -1.800 7.6e-21
malignant mesothelioma 1.300 6.6e-07
osteosarcoma -1.133 6.9e-03
ovarian cancer 1.400 5.8e-04
pancreatic cancer 1.300 9.6e-06
primary pancreatic ductal adenocarcinoma 1.382 1.1e-02
psoriasis 1.300 9.1e-06
tuberculosis 1.200 4.0e-04

Gene RIF (142)

AA Sequence

MEGAALLRVSVLCIWMSALFLGVGVRAEEAGARVQQNVPSGTDTGDPQSKPLGDWAAGTMDPESSIFIED      1 - 70
AIKYFKEKVSTQNLLLLLTDNEAWNGFVAAAELPRNEADELRKALDNLARQMIMKDKNWHDKGQQYRNWF     71 - 140
LKEFPRLKSELEDNIRRLRALADGVQKVHKGTTIANVVSGSLSISSGILTLVGMGLAPFTEGGSLVLLEP    141 - 210
GMELGITAALTGITSSTMDYGKKWWTQAQAHDLVIKSLDKLKEVREFLGENISNFLSLAGNTYQLTRGIG    211 - 280
KDIRALRRARANLQSVPHASASRPRVTEPISAESGEQVERVNEPSILEMSRGVKLTDVAPVSFFLVLDVV    281 - 350
YLVYESKHLHEGAKSETAEELKKVAQELEEKLNILNNNYKILQADQEL                          351 - 398
//

Text Mined References (154)

PMID Year Title