Property Summary

NCBI Gene PubMed Count 496
Grant Count 1,079
R01 Count 674
Funding $110,208,868.79
PubMed Score 3934.60
PubTator Score 1951.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
osteosarcoma 1.340 0.004
tuberculosis -1.100 0.000
intraductal papillary-mucinous carcinoma... 1.900 0.005
intraductal papillary-mucinous neoplasm ... 1.500 0.020
lung cancer 1.800 0.000
pancreatic cancer 1.400 0.002
cystic fibrosis -1.300 0.001
nasopharyngeal carcinoma -1.200 0.002
inflammatory breast cancer -1.400 0.009
ulcerative colitis 1.400 0.001
ovarian cancer 1.100 0.000
pituitary cancer 1.100 0.003

Synonym

Accession O14788 O14723 Q96Q17 Q9P2Q3
Symbols ODF
OPGL
sOdf
CD254
OPTB2
RANKL
TNLG6B
TRANCE
hRANKL2

Gene

PDB

3URF   5BNQ  

Gene RIF (488)

PMID Text
26975539 The plasma OPG level is negatively associated with nonalcoholic fatty liver disease independent of potential cofounders
26894886 Mast cell density and expression of MMP-9, RANKL and Ntx correlated positively with of bone disease severity in multiple myeloma patients.
26722486 Hypoxia can affect the expression of RANKL and OPG in human periodontal ligament cells
26635910 the independent and positive (beta = 0.449, p = 0.004, and R(2) = 0.185) association between the OxS marker and RANKL/OPG ratio which was found in osteopenic but not in the other 2 sample groups.
26629528 Osteoprotegerin (OPG), The Endogenous Inhibitor of Receptor Activator of NF-kappaB Ligand (RANKL), is Dysregulated in BRCA Mutation Carriers
26621504 In conclusion, rheumatoid arthritis synovial fibroblasts were activated by CXCL16 to produce RANKL via pathways involving JAK2/STAT3 and p38/MAPK
26617755 expression of OPG, RANK and RANKL genes exert a crucial role in the progression of avascular necrosis
26554541 Switched memory B cells from RA patients expressed significantly more RANKL compared to healthy controls. B cells supported osteoclast differentiation in vitro in a RANKL-dependent manner.
26506085 Atorvastatin treatment reduced circulating osteoprogenitor cells and RANKL expression in T cells, and increased OPG serum levels in postmenopausal osteoporisis.
26420479 IL-29 directly induces RANKL expression in rheumatoid arthritis-fibroblasts like synoviocytes via MAPK signaling pathway.
More...

AA Sequence

MRRASRDYTKYLRGSEEMGGGPGAPHEGPLHAPPPPAPHQPPAASRSMFVALLGLGLGQVVCSVALFFYF      1 - 70
RAQMDPNRISEDGTHCIYRILRLHENADFQDTTLESQDTKLIPDSCRRIKQAFQGAVQKELQHIVGSQHI     71 - 140
RAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQ    141 - 210
DGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGF    211 - 280
FKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID                                     281 - 317
//

Text Mined References (496)

PMID Year Title
26975539 2016 Plasma osteoprotegerin levels are inversely associated with nonalcoholic fatty liver disease in patients with type 2 diabetes: A case-control study in China.
26894886 2015 The Impact of Mast Cell Density on the Progression of Bone Disease in Multiple Myeloma Patients.
26722486 2015 Effect of hypoxia on the expression of RANKL/OPG in human periodontal ligament cells in vitro.
26646413 2016 Comparative genomic analysis of eutherian tumor necrosis factor ligand genes.
26635910 2016 Higher Urinary Levels of 8-Hydroxy-2'-deoxyguanosine Are Associated with a Worse RANKL/OPG Ratio in Postmenopausal Women with Osteopenia.
26629528 2015 Osteoprotegerin (OPG), The Endogenous Inhibitor of Receptor Activator of NF-?B Ligand (RANKL), is Dysregulated in BRCA Mutation Carriers.
26621504 2016 CXCL16 upregulates RANKL expression in rheumatoid arthritis synovial fibroblasts through the JAK2/STAT3 and p38/MAPK signaling pathway.
26617755 2015 Expression of osteoprotegerin, RNAK and RANKL genes in femoral head avascular necrosis and related signaling pathway.
26554541 2016 Production of RANKL by Memory B Cells: A Link Between B Cells and Bone Erosion in Rheumatoid Arthritis.
26506085 2016 Atorvastatin Reduces Circulating Osteoprogenitor Cells and T-Cell RANKL Expression in Osteoporotic Women: Implications for the Bone-Vascular Axis.
More...