Property Summary

NCBI Gene PubMed Count 496
PubMed Score 3934.60
PubTator Score 1951.46

Knowledge Summary


No data available


  Disease Sources (6)

Disease Target Count P-value
ovarian cancer 8492 1.40286124368657E-9
tuberculosis 1563 9.59946128292162E-5
lung cancer 4473 2.9259142816206E-4
cystic fibrosis 1670 8.15305287931781E-4
ulcerative colitis 2087 9.06037576113677E-4
pancreatic cancer 2300 0.00180384395807027
nasopharyngeal carcinoma 1056 0.00197904021008065
pituitary cancer 1972 0.00292373063105486
osteosarcoma 7933 0.00410590337420182
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00535578183346445
inflammatory breast cancer 404 0.00944636368289751
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0204820531437413


  Differential Expression (12)

Disease log2 FC p
osteosarcoma 1.340 0.004
tuberculosis -1.100 0.000
intraductal papillary-mucinous carcinoma... 1.900 0.005
intraductal papillary-mucinous neoplasm ... 1.500 0.020
lung cancer 1.800 0.000
pancreatic cancer 1.400 0.002
cystic fibrosis -1.300 0.001
nasopharyngeal carcinoma -1.200 0.002
inflammatory breast cancer -1.400 0.009
ulcerative colitis 1.400 0.001
ovarian cancer 1.100 0.000
pituitary cancer 1.100 0.003


Accession O14788 O14723 Q96Q17 Q9P2Q3
Symbols ODF



3URF   5BNQ  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (486)

26975539 The plasma OPG level is negatively associated with nonalcoholic fatty liver disease independent of potential cofounders
26894886 Mast cell density and expression of MMP-9, RANKL and Ntx correlated positively with of bone disease severity in multiple myeloma patients.
26722486 Hypoxia can affect the expression of RANKL and OPG in human periodontal ligament cells
26635910 the independent and positive (beta = 0.449, p = 0.004, and R(2) = 0.185) association between the OxS marker and RANKL/OPG ratio which was found in osteopenic but not in the other 2 sample groups.
26629528 Osteoprotegerin (OPG), The Endogenous Inhibitor of Receptor Activator of NF-kappaB Ligand (RANKL), is Dysregulated in BRCA Mutation Carriers
26621504 In conclusion, rheumatoid arthritis synovial fibroblasts were activated by CXCL16 to produce RANKL via pathways involving JAK2/STAT3 and p38/MAPK
26617755 expression of OPG, RANK and RANKL genes exert a crucial role in the progression of avascular necrosis
26554541 Switched memory B cells from RA patients expressed significantly more RANKL compared to healthy controls. B cells supported osteoclast differentiation in vitro in a RANKL-dependent manner.
26506085 Atorvastatin treatment reduced circulating osteoprogenitor cells and RANKL expression in T cells, and increased OPG serum levels in postmenopausal osteoporisis.
26420479 IL-29 directly induces RANKL expression in rheumatoid arthritis-fibroblasts like synoviocytes via MAPK signaling pathway.

AA Sequence

FKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID                                     281 - 317

Text Mined References (496)

PMID Year Title
26975539 2016 Plasma osteoprotegerin levels are inversely associated with nonalcoholic fatty liver disease in patients with type 2 diabetes: A case-control study in China.
26894886 2015 The Impact of Mast Cell Density on the Progression of Bone Disease in Multiple Myeloma Patients.
26722486 2015 Effect of hypoxia on the expression of RANKL/OPG in human periodontal ligament cells in vitro.
26646413 2016 Comparative genomic analysis of eutherian tumor necrosis factor ligand genes.
26635910 2016 Higher Urinary Levels of 8-Hydroxy-2'-deoxyguanosine Are Associated with a Worse RANKL/OPG Ratio in Postmenopausal Women with Osteopenia.
26629528 2015 Osteoprotegerin (OPG), The Endogenous Inhibitor of Receptor Activator of NF-?B Ligand (RANKL), is Dysregulated in BRCA Mutation Carriers.
26621504 2016 CXCL16 upregulates RANKL expression in rheumatoid arthritis synovial fibroblasts through the JAK2/STAT3 and p38/MAPK signaling pathway.
26617755 2015 Expression of osteoprotegerin, RNAK and RANKL genes in femoral head avascular necrosis and related signaling pathway.
26554541 2016 Production of RANKL by Memory B Cells: A Link Between B Cells and Bone Erosion in Rheumatoid Arthritis.
26506085 2016 Atorvastatin Reduces Circulating Osteoprogenitor Cells and T-Cell RANKL Expression in Osteoporotic Women: Implications for the Bone-Vascular Axis.