Property Summary

NCBI Gene PubMed Count 16
PubMed Score 7.79
PubTator Score 9.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
psoriasis -1.400 0.000
osteosarcoma 1.552 0.000
atypical teratoid / rhabdoid tumor -1.400 0.000
glioblastoma -1.600 0.000
medulloblastoma, large-cell -1.600 0.000
pancreatic ductal adenocarcinoma liver m... 1.195 0.018
adult high grade glioma -1.700 0.000
group 4 medulloblastoma -1.300 0.001
non primary Sjogren syndrome sicca 1.100 0.017
ovarian cancer -1.100 0.000

Synonym

Accession O14787 O14655 Q6IN77
Symbols IPO3
TRN2
KPNB2B

Gene

PANTHER Protein Class (1)

Gene RIF (7)

PMID Text
26060253 IPO3 binds NEMO, promotes its nuclear import, and is critical for DNA damage-dependent NF-kappaB activation.
24780099 Studies indicate potential roles of Tranportin-1 and Transportin-2 beyond protein nuclear import.
21646354 a role for the nuclear trafficking factor TRN2 (transportin 2) through HuR in cell death
20606625 Nuclear import of fused in sarcoma (FUS) is dependent on Transportin, and interference with this transport pathway leads to cytoplasmic redistribution and recruitment of fused in sarcoma (FUS) into stress granules.
16901787 The structure of Kap beta 2 (also known as Transportin) bound to one of its substrates, the NLS of hnRNP A1, that we report here explains the mechanism of substrate displacement by Ran GTPase.
14981248 Transportin-2 mediates nuclear import of HuR protein in vitro
12384575 Karyopherin beta 2B participates in mRNA export from the nucleus

AA Sequence

MDWQPDEQGLQQVLQLLKDSQSPNTATQRIVQDKLKQLNQFPDFNNYLIFVLTRLKSEDEPTRSLSGLIL      1 - 70
KNNVKAHYQSFPPPVADFIKQECLNNIGDASSLIRATIGILITTIASKGELQMWPELLPQLCNLLNSEDY     71 - 140
NTCEGAFGALQKICEDSSELLDSDALNRPLNIMIPKFLQFFKHCSPKIRSHAIACVNQFIMDRAQALMDN    141 - 210
IDTFIEHLFALAVDDDPEVRKNVCRALVMLLEVRIDRLIPHMHSIIQYMLQRTQDHDENVALEACEFWLT    211 - 280
LAEQPICKEVLASHLVQLIPILVNGMKYSEIDIILLKGDVEEDEAVPDSEQDIKPRFHKSRTVTLPHEAE    281 - 350
RPDGSEDAEDDDDDDALSDWNLRKCSAAALDVLANVFREELLPHLLPLLKGLLFHPEWVVKESGILVLGA    351 - 420
IAEGCMQGMVPYLPELIPHLIQCLSDKKALVRSIACWTLSRYAHWVVSQPPDMHLKPLMTELLKRILDGN    421 - 490
KRVQEAACSAFATLEEEACTELVPYLSYILDTLVFAFGKYQHKNLLILYDAIGTLADSVGHHLNQPEYIQ    491 - 560
KLMPPLIQKWNELKDEDKDLFPLLECLSSVATALQSGFLPYCEPVYQRCVTLVQKTLAQAMMYTQHPEQY    561 - 630
EAPDKDFMIVALDLLSGLAEGLGGHVEQLVARSNIMTLLFQCMQDSMPEVRQSSFALLGDLTKACFIHVK    631 - 700
PCIAEFMPILGTNLNPEFISVCNNATWAIGEICMQMGAEMQPYVQMVLNNLVEIINRPNTPKTLLENTGR    701 - 770
LTSPSAIPAITIGRLGYVCPQEVAPMLQQFIRPWCTSLRNIRDNEEKDSAFRGICMMIGVNPGGVVQDFI    771 - 840
FFCDAVASWVSPKDDLRDMFYKILHGFKDQVGEDNWQQFSEQFPPLLKERLAAFYGV                 841 - 897
//

Text Mined References (21)

PMID Year Title
26060253 2015 IPO3-mediated Nonclassical Nuclear Import of NF-?B Essential Modulator (NEMO) Drives DNA Damage-dependent NF-?B Activation.
25416956 2014 A proteome-scale map of the human interactome network.
24780099 2014 Transportin-1 and Transportin-2: protein nuclear import and beyond.
23033978 2012 Diagnostic exome sequencing in persons with severe intellectual disability.
21646354 2011 Transportin 2 regulates apoptosis through the RNA-binding protein HuR.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20606625 2010 ALS-associated fused in sarcoma (FUS) mutations disrupt Transportin-mediated nuclear import.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
More...