Property Summary

NCBI Gene PubMed Count 210
Grant Count 213
R01 Count 113
Funding $17,821,258.2
PubMed Score 481.00
PubTator Score 453.32

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O14786 B0LPG9 O60461 Q5T7F1 Q5T7F2 Q5T7F3 Q86T59 Q96I90 Q96IH5
Symbols NP1
NRP
BDCA4
CD304
VEGF165R

Gene

PDB

4DEQ   2QQN   1KEX   2QQI   2QQM   3I97   4RN5   5C7G  

Gene RIF (177)

PMID Text
26877262 neuropilin-1 is regulated in the oral epithelium and is selectively up-regulated during epithelial dysplasia
26823738 miR-152 suppression in NSCLC cells might promote neuropilin-1 mediated cancer metastasis.
26805761 VEGF/NRP-1axis promotes progression of breast cancer via enhancement of epithelial-mesenchymal transition and activation of NF-kappaB and beta-catenin.
26795388 NRP-1 was found to be overexpressed in gastric cancer (GC) tissues, and its expression correlates with the clinical staging, tumor differentiation and pathological types of gastric cancer.
26708340 Both placental NRP1 and VEGF were expressed at lower levels in women with pre-eclampsia and homocysteine-treated mice, which may contribute to endothelial damage.
26602825 Semaphorin-3a, neuropilin-1 and plexin-A1 are axonal guidance molecules that have been recently implicated in regulating bone metabolism.
26573160 NRP1 was targeted by miR130a and miR130b at the binding site of chromosome 10: 334668643466870, which was involved in the axon guidance signaling pathway.
26451046 Neuropilin has a role as an essential cell surface receptor [review]
26409917 Study found significant down-regulation of placental NRP-1 expression in fetal growth restriction pregnancies complicated with absent end-diastolic flow in the umbilical artery.
26408254 Data show that binding of pleiotrophin (PTN) to neuropilin-1 (NRP-1) stimulated the internalization and recycling of NRP-1 at the cell surface.
More...

AA Sequence

MERGLPLLCAVLALVLAPAGAFRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQAPDPYQRIMIN      1 - 70
FNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLFIKFVSDYETHGAGFSIRYEI     71 - 140
FKRGPECSQNYTTPSGVIKSPGFPEKYPNSLECTYIVFVPKMSEIILEFESFDLEPDSNPPGGMFCRYDR    141 - 210
LEIWDGFPDVGPHIGRYCGQKTPGRIRSSSGILSMVFYTDSAIAKEGFSANYSVLQSSVSEDFKCMEALG    211 - 280
MESGEIHSDQITASSQYSTNWSAERSRLNYPENGWTPGEDSYREWIQVDLGLLRFVTAVGTQGAISKETK    281 - 350
KKYYVKTYKIDVSSNGEDWITIKEGNKPVLFQGNTNPTDVVVAVFPKPLITRFVRIKPATWETGISMRFE    351 - 420
VYGCKITDYPCSGMLGMVSGLISDSQITSSNQGDRNWMPENIRLVTSRSGWALPPAPHSYINEWLQIDLG    421 - 490
EEKIVRGIIIQGGKHRENKVFMRKFKIGYSNNGSDWKMIMDDSKRKAKSFEGNNNYDTPELRTFPALSTR    491 - 560
FIRIYPERATHGGLGLRMELLGCEVEAPTAGPTTPNGNLVDECDDDQANCHSGTGDDFQLTGGTTVLATE    561 - 630
KPTVIDSTIQSEFPTYGFNCEFGWGSHKTFCHWEHDNHVQLKWSVLTSKTGPIQDHTGDGNFIYSQADEN    631 - 700
QKGKVARLVSPVVYSQNSAHCMTFWYHMSGSHVGTLRVKLRYQKPEEYDQLVWMAIGHQGDHWKEGRVLL    701 - 770
HKSLKLYQVIFEGEIGKGNLGGIAVDDISINNHISQEDCAKPADLDKKNPEIKIDETGSTPGYEGEGEGD    771 - 840
KNISRKPGNVLKTLDPILITIIAMSALGVLLGAVCGVVLYCACWHNGMSERNLSALENYNFELVDGVKLK    841 - 910
KDKLNTQSTYSEA                                                             911 - 923
//

Text Mined References (215)

PMID Year Title
26877262 2016 Neuropilin 1 Receptor Is Up-Regulated in Dysplastic Epithelium and Oral Squamous Cell Carcinoma.
26823738 2015 MiR-152 regulates metastases of non-small cell lung cancer cells by targeting neuropilin-1.
26805761 2016 VEGF/NRP-1axis promotes progression of breast cancer via enhancement of epithelial-mesenchymal transition and activation of NF-?B and ?-catenin.
26795388 2016 Neuropilin-1 is associated with clinicopathology of gastric cancer and contributes to cell proliferation and migration as multifunctional co-receptors.
26708340 2016 Placental NRP1 and VEGF expression in pre-eclamptic women and in a homocysteine-treated mouse model of pre-eclampsia.
26602825 2016 Semaphorin-3a, neuropilin-1 and plexin-A1 in prosthetic-particle induced bone loss.
26573160 2016 NRP1 is targeted by miR-130a and miR-130b, and is associated with multidrug resistance in epithelial ovarian cancer based on integrated gene network analysis.
26451046 2015 Neuropilin Functions as an Essential Cell Surface Receptor.
26409917 2016 Down-regulation of placental neuropilin-1 in fetal growth restriction.
26408254 2015 Pleiotrophin exerts its migration and invasion effect through the neuropilin-1 pathway.
More...