Property Summary

NCBI Gene PubMed Count 9
Grant Count 1
R01 Count 1
Funding $60,682
PubMed Score 3.77
PubTator Score 6.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma -2.900 0.000
astrocytic glioma -1.600 0.002
posterior fossa group B ependymoma -3.100 0.000
glioblastoma -2.200 0.000
oligodendroglioma -1.200 0.000
medulloblastoma -1.300 0.000
atypical teratoid / rhabdoid tumor -2.600 0.000
medulloblastoma, large-cell -2.000 0.000
non-small cell lung cancer 1.210 0.000
lung cancer 2.300 0.000
adult high grade glioma -2.600 0.000
pilocytic astrocytoma -1.300 0.000
subependymal giant cell astrocytoma -1.694 0.014
lung carcinoma 1.800 0.000
invasive ductal carcinoma 1.100 0.013

Gene RIF (3)

PMID Text
26272184 Results suggest that high expression of KIF3C in breast cancer may be associated with tumor progression and metastasis.
18187620 Knockdown of kinesin family member 3C (KIF3C) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17881655 FMRP acts also as a molecular adaptor between RNA granules and the neurospecific kinesin KIF3C.

AA Sequence

MASKTKASEALKVVARCRPLSRKEEAAGHEQILTMDVKLGQVTLRNPRAAPGELPKTFTFDAVYDASSKQ      1 - 70
ADLYDETVRPLIDSVLQGFNGTVFAYGQTGTGKTYTMQGTWVEPELRGVIPNAFEHIFTHISRSQNQQYL     71 - 140
VRASYLEIYQEEIRDLLSKEPGKRLELKENPETGVYIKDLSSFVTKNVKEIEHVMNLGNQTRAVGSTHMN    141 - 210
EVSSRSHAIFIITVECSERGSDGQDHIRVGKLNLVDLAGSERQNKAGPNTAGGAATPSSGGGGGGGGSGG    211 - 280
GAGGERPKEASKINLSLSALGNVIAALAGNRSTHIPYRDSKLTRLLQDSLGGNAKTIMVATLGPASHSYD    281 - 350
ESLSTLRFANRAKNIKNKPQVNEDPKDTLLREFQEEIARLKAQLEKRGMLGKRPRRKSSRRKKAVSAPPG    351 - 420
YPEGPVIEAWVAEEEDDNNNNHRPPQPILESALEKNMENYLQEQKERLEEEKAAIQDDRSLVSEEKQKLL    421 - 490
EEKEKMLEDLRREQQATELLAAKYKAMESKLLIGGRNIMDHTNEQQKMLELKRQEIAEQKRREREMQQEM    491 - 560
MLRDEETMELRGTYTSLQQEVEVKTKKLKKLYAKLQAVKAEIQDQHDEYIRVRQDLEEAQNEQTRELKLK    561 - 630
YLIIENFIPPEEKNKIMNRLFLDCEEEQWKFQPLVPAGVSSSQMKKRPTSAVGYKRPISQYARVAMAMGS    631 - 700
HPRYRAENIMFLELDVSPPAVFEMEFSHDQEQDPRALHMERLMRLDSFLERPSTSKVRKSRSWCQSPQRP    701 - 770
PPSTTHASLASASLRPATVADHE                                                   771 - 793
//

Text Mined References (10)

PMID Year Title
26272184 2015 Suppression of motor protein KIF3C expression inhibits tumor growth and metastasis in breast cancer by inhibiting TGF-? signaling.
17881655 2007 The fragile X mental retardation protein is a molecular adaptor between the neurospecific KIF3C kinesin and dendritic RNA granules.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9487132 1998 KIF3C and KIF3A form a novel neuronal heteromeric kinesin that associates with membrane vesicles.
9480755 1998 KIF3C, a novel member of the kinesin superfamily: sequence, expression, and mapping to human chromosome 2 at 2p23.
9450952 1998 Characterization of the KIF3C neural kinesin-like motor from mouse.
9446808 1998 cDNA cloning, genomic organization, and chromosomal localization of a novel human gene that encodes a kinesin-related protein highly similar to mouse Kif3C.