Property Summary

NCBI Gene PubMed Count 9
PubMed Score 4.15
PubTator Score 6.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -2.600 2.2e-08
astrocytic glioma -1.600 1.8e-03
Astrocytoma, Pilocytic -1.300 1.3e-06
atypical teratoid / rhabdoid tumor -2.600 1.4e-08
ependymoma -2.300 2.2e-02
glioblastoma -2.000 2.6e-11
invasive ductal carcinoma 1.100 1.3e-02
lung cancer 1.400 3.4e-03
lung carcinoma 1.800 2.4e-41
malignant mesothelioma -2.600 1.6e-05
medulloblastoma -1.100 1.0e-05
medulloblastoma, large-cell -2.000 2.1e-06
non-small cell lung cancer 1.210 2.2e-13
oligodendroglioma -1.200 1.8e-12
subependymal giant cell astrocytoma -1.694 1.4e-02

Protein-protein Interaction (2)

Gene RIF (3)

AA Sequence

MASKTKASEALKVVARCRPLSRKEEAAGHEQILTMDVKLGQVTLRNPRAAPGELPKTFTFDAVYDASSKQ      1 - 70
ADLYDETVRPLIDSVLQGFNGTVFAYGQTGTGKTYTMQGTWVEPELRGVIPNAFEHIFTHISRSQNQQYL     71 - 140
VRASYLEIYQEEIRDLLSKEPGKRLELKENPETGVYIKDLSSFVTKNVKEIEHVMNLGNQTRAVGSTHMN    141 - 210
EVSSRSHAIFIITVECSERGSDGQDHIRVGKLNLVDLAGSERQNKAGPNTAGGAATPSSGGGGGGGGSGG    211 - 280
GAGGERPKEASKINLSLSALGNVIAALAGNRSTHIPYRDSKLTRLLQDSLGGNAKTIMVATLGPASHSYD    281 - 350
ESLSTLRFANRAKNIKNKPQVNEDPKDTLLREFQEEIARLKAQLEKRGMLGKRPRRKSSRRKKAVSAPPG    351 - 420
YPEGPVIEAWVAEEEDDNNNNHRPPQPILESALEKNMENYLQEQKERLEEEKAAIQDDRSLVSEEKQKLL    421 - 490
EEKEKMLEDLRREQQATELLAAKYKAMESKLLIGGRNIMDHTNEQQKMLELKRQEIAEQKRREREMQQEM    491 - 560
MLRDEETMELRGTYTSLQQEVEVKTKKLKKLYAKLQAVKAEIQDQHDEYIRVRQDLEEAQNEQTRELKLK    561 - 630
YLIIENFIPPEEKNKIMNRLFLDCEEEQWKFQPLVPAGVSSSQMKKRPTSAVGYKRPISQYARVAMAMGS    631 - 700
HPRYRAENIMFLELDVSPPAVFEMEFSHDQEQDPRALHMERLMRLDSFLERPSTSKVRKSRSWCQSPQRP    701 - 770
PPSTTHASLASASLRPATVADHE                                                   771 - 793
//

Text Mined References (11)

PMID Year Title