Property Summary

NCBI Gene PubMed Count 77
Grant Count 41
R01 Count 26
Funding $5,262,797.31
PubMed Score 253.32
PubTator Score 201.99

Knowledge Summary

Patent

No data available

Expression

Gene RIF (43)

PMID Text
26612002 we conclude that Hec1 is consistently overexpressed in human PCa and Hec1 is closely linked with human PCa progression through the meditator LncRNA BX647187
25808492 Independent molecular binding events to microtubules (MTs) by individual NDC80 complexes, rather than their structured oligomers, regulate the dynamics and stability of kinetochore-MT attachments in dividing cells.
25601404 Mechanisms of mitosis-specific assembly of the checkpoint platform Knl1/MIS12/NDC80 at human kinetochores.
25557589 Overproduction of Ndc80 in cancer cells may unfavourably absorb protein interactors through the internal loop domain and lead to a change in the equilibrium of microtubule-associated proteins. [Review]
25132262 N-terminus-modified Hec1 suppresses tumour growth by interfering with kinetochore-microtubule dynamics
24694948 Certain clinical subtypes of breast cancer more likely to respond to Hec1-targeted therapy were identified and these subtypes are the ones associated with poor prognosis.
24413531 The Ndc80 complex binds straight microtubules by recognizing the dimeric interface of tubulin.
24327015 Growth inhibition following knockdown of NDC80, CDK1 and PLK1.
24187132 a novel role for Aurora B-Hec1-Mps1 signaling axis in governing accurate chromosome segregation in mitosis
24129578 these findings demonstrated that three buried glutamic acid-lysine pairs, in concert with hydrophobic interactions of core residues, provide the major specificity and stability requirements for Hec1-Nuf2 dimerization
More...

AA Sequence

MKRSSVSSGGAGRLSMQELRSQDVNKQGLYTPQTKEKPTFGKLSINKPTSERKVSLFGKRTSGHGSRNSQ      1 - 70
LGIFSSSEKIKDPRPLNDKAFIQQCIRQLCEFLTENGYAHNVSMKSLQAPSVKDFLKIFTFLYGFLCPSY     71 - 140
ELPDTKFEEEVPRIFKDLGYPFALSKSSMYTVGAPHTWPHIVAALVWLIDCIKIHTAMKESSPLFDDGQP    141 - 210
WGEETEDGIMHNKLFLDYTIKCYESFMSGADSFDEMNAELQSKLKDLFNVDAFKLESLEAKNRALNEQIA    211 - 280
RLEQEREKEPNRLESLRKLKASLQGDVQKYQAYMSNLESHSAILDQKLNGLNEEIARVELECETIKQENT    281 - 350
RLQNIIDNQKYSVADIERINHERNELQQTINKLTKDLEAEQQKLWNEELKYARGKEAIETQLAEYHKLAR    351 - 420
KLKLIPKGAENSKGYDFEIKFNPEAGANCLVKYRAQVYVPLKELLNETEEEINKALNKKMGLEDTLEQLN    421 - 490
AMITESKRSVRTLKEEVQKLDDLYQQKIKEAEEEDEKCASELESLEKHKHLLESTVNQGLSEAMNELDAV    491 - 560
QREYQLVVQTTTEERRKVGNNLQRLLEMVATHVGSVEKHLEEQIAKVDREYEECMSEDLSENIKEIRDKY    561 - 630
EKKATLIKSSEE                                                              631 - 642
//

Text Mined References (82)

PMID Year Title
27156448 2016 A TOG Protein Confers Tension Sensitivity to Kinetochore-Microtubule Attachments.
26612002 2015 The mitotic regulator Hec1 is a critical modulator of prostate cancer through the long non-coding RNA BX647187 in vitro.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25808492 2015 Multisite phosphorylation of the NDC80 complex gradually tunes its microtubule-binding affinity.
25743205 2015 Chromokinesin Kid and kinetochore kinesin CENP-E differentially support chromosome congression without end-on attachment to microtubules.
25601404 2015 Multiple assembly mechanisms anchor the KMN spindle checkpoint platform at human mitotic kinetochores.
25557589 2015 MAPping the Ndc80 loop in cancer: A possible link between Ndc80/Hec1 overproduction and cancer formation.
25416956 2014 A proteome-scale map of the human interactome network.
25132262 2015 N-terminus-modified Hec1 suppresses tumour growth by interfering with kinetochore-microtubule dynamics.
24694948 2014 Activity of a novel Hec1-targeted anticancer compound against breast cancer cell lines in vitro and in vivo.
More...