Tchem | Kinetochore protein NDC80 homolog |
Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity (PubMed:9315664, PubMed:12351790, PubMed:14654001, PubMed:14699129, PubMed:15062103, PubMed:15235793, PubMed:15239953, PubMed:15548592, PubMed:16732327). Required for kinetochore integrity and the organization of stable microtubule binding sites in the outer plate of the kinetochore (PubMed:15548592). The NDC80 complex synergistically enhances the affinity of the SKA1 complex for microtubules and may allow the NDC80 complex to track depolymerizing microtubules (PubMed:23085020). Plays a role in chromosome congression and is essential for the end-on attachment of the kinetochores to spindle microtubules (PubMed:25743205, PubMed:23891108).
This gene encodes a component of the NDC80 kinetochore complex. The encoded protein consists of an N-terminal microtubule binding domain and a C-terminal coiled-coiled domain that interacts with other components of the complex. This protein functions to organize and stabilize microtubule-kinetochore interactions and is required for proper chromosome segregation. [provided by RefSeq, Oct 2011]
This gene encodes a component of the NDC80 kinetochore complex. The encoded protein consists of an N-terminal microtubule binding domain and a C-terminal coiled-coiled domain that interacts with other components of the complex. This protein functions to organize and stabilize microtubule-kinetochore interactions and is required for proper chromosome segregation. [provided by RefSeq, Oct 2011]
Comments
Disease | Target Count |
---|---|
IGA Glomerulonephritis | 454 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA Inparanoid |
Dog | OMA EggNOG Inparanoid |
Horse | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Pig | OMA EggNOG |
Opossum | OMA EggNOG Inparanoid |
Platypus | OMA EggNOG Inparanoid |
Chicken | OMA EggNOG Inparanoid |
Anole lizard | OMA EggNOG Inparanoid |
Xenopus | OMA EggNOG Inparanoid |
Zebrafish | OMA EggNOG Inparanoid |
C. elegans | OMA Inparanoid |
Fruitfly | EggNOG Inparanoid |
S.cerevisiae | OMA EggNOG Inparanoid |
PMID | Text |
---|---|
26612002 | we conclude that Hec1 is consistently overexpressed in human PCa and Hec1 is closely linked with human PCa progression through the meditator LncRNA BX647187 |
25808492 | Independent molecular binding events to microtubules (MTs) by individual NDC80 complexes, rather than their structured oligomers, regulate the dynamics and stability of kinetochore-MT attachments in dividing cells. |
25601404 | Mechanisms of mitosis-specific assembly of the checkpoint platform Knl1/MIS12/NDC80 at human kinetochores. |
25557589 | Overproduction of Ndc80 in cancer cells may unfavourably absorb protein interactors through the internal loop domain and lead to a change in the equilibrium of microtubule-associated proteins. [Review] |
25132262 | N-terminus-modified Hec1 suppresses tumour growth by interfering with kinetochore-microtubule dynamics |
24694948 | Certain clinical subtypes of breast cancer more likely to respond to Hec1-targeted therapy were identified and these subtypes are the ones associated with poor prognosis. |
24413531 | The Ndc80 complex binds straight microtubules by recognizing the dimeric interface of tubulin. |
24327015 | Growth inhibition following knockdown of NDC80, CDK1 and PLK1. |
24187132 | a novel role for Aurora B-Hec1-Mps1 signaling axis in governing accurate chromosome segregation in mitosis |
24129578 | these findings demonstrated that three buried glutamic acid-lysine pairs, in concert with hydrophobic interactions of core residues, provide the major specificity and stability requirements for Hec1-Nuf2 dimerization |
More... |
MKRSSVSSGGAGRLSMQELRSQDVNKQGLYTPQTKEKPTFGKLSINKPTSERKVSLFGKRTSGHGSRNSQ 1 - 70 LGIFSSSEKIKDPRPLNDKAFIQQCIRQLCEFLTENGYAHNVSMKSLQAPSVKDFLKIFTFLYGFLCPSY 71 - 140 ELPDTKFEEEVPRIFKDLGYPFALSKSSMYTVGAPHTWPHIVAALVWLIDCIKIHTAMKESSPLFDDGQP 141 - 210 WGEETEDGIMHNKLFLDYTIKCYESFMSGADSFDEMNAELQSKLKDLFNVDAFKLESLEAKNRALNEQIA 211 - 280 RLEQEREKEPNRLESLRKLKASLQGDVQKYQAYMSNLESHSAILDQKLNGLNEEIARVELECETIKQENT 281 - 350 RLQNIIDNQKYSVADIERINHERNELQQTINKLTKDLEAEQQKLWNEELKYARGKEAIETQLAEYHKLAR 351 - 420 KLKLIPKGAENSKGYDFEIKFNPEAGANCLVKYRAQVYVPLKELLNETEEEINKALNKKMGLEDTLEQLN 421 - 490 AMITESKRSVRTLKEEVQKLDDLYQQKIKEAEEEDEKCASELESLEKHKHLLESTVNQGLSEAMNELDAV 491 - 560 QREYQLVVQTTTEERRKVGNNLQRLLEMVATHVGSVEKHLEEQIAKVDREYEECMSEDLSENIKEIRDKY 561 - 630 EKKATLIKSSEE 631 - 642 //
PMID | Year | Title |
---|---|---|
27156448 | 2016 | A TOG Protein Confers Tension Sensitivity to Kinetochore-Microtubule Attachments. |
26612002 | 2015 | The mitotic regulator Hec1 is a critical modulator of prostate cancer through the long non-coding RNA BX647187 in vitro. |
26496610 | 2015 | A human interactome in three quantitative dimensions organized by stoichiometries and abundances. |
25808492 | 2015 | Multisite phosphorylation of the NDC80 complex gradually tunes its microtubule-binding affinity. |
25743205 | 2015 | Chromokinesin Kid and kinetochore kinesin CENP-E differentially support chromosome congression without end-on attachment to microtubules. |
25601404 | 2015 | Multiple assembly mechanisms anchor the KMN spindle checkpoint platform at human mitotic kinetochores. |
25557589 | 2015 | MAPping the Ndc80 loop in cancer: A possible link between Ndc80/Hec1 overproduction and cancer formation. |
25416956 | 2014 | A proteome-scale map of the human interactome network. |
25132262 | 2015 | N-terminus-modified Hec1 suppresses tumour growth by interfering with kinetochore-microtubule dynamics. |
24694948 | 2014 | Activity of a novel Hec1-targeted anticancer compound against breast cancer cell lines in vitro and in vivo. |
More... |