Property Summary

NCBI Gene PubMed Count 84
PubMed Score 265.16
PubTator Score 201.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (31)

Disease log2 FC p
adrenocortical carcinoma 2.297 2.0e-04
adult high grade glioma 2.800 5.1e-07
astrocytoma 1.100 1.3e-05
Astrocytoma, Pilocytic 1.600 1.3e-04
Atopic dermatitis 2.400 1.2e-05
atypical teratoid / rhabdoid tumor 3.500 2.3e-10
Breast cancer 2.800 2.6e-02
breast carcinoma 1.500 6.0e-04
colon cancer 1.500 4.8e-02
ductal carcinoma in situ 2.100 7.6e-03
Endometriosis 2.161 1.0e-02
ependymoma 2.600 8.4e-09
glioblastoma 3.800 1.1e-11
group 3 medulloblastoma 4.900 8.1e-09
interstitial cystitis 1.400 1.3e-02
intraductal papillary-mucinous carcinoma... 3.100 4.4e-04
intraductal papillary-mucinous neoplasm ... 3.900 1.4e-03
invasive ductal carcinoma 2.400 4.7e-04
lung adenocarcinoma 1.100 4.4e-08
lung cancer 2.700 8.2e-04
malignant mesothelioma 2.000 5.1e-08
medulloblastoma, large-cell 3.900 2.3e-07
nasopharyngeal carcinoma 1.900 2.0e-05
non-small cell lung cancer 2.911 1.5e-29
oligodendroglioma 1.300 9.7e-05
ovarian cancer 1.500 1.4e-02
pancreatic cancer 1.500 1.2e-04
primary Sjogren syndrome 1.600 1.7e-03
primitive neuroectodermal tumor 4.400 3.3e-07
psoriasis 1.200 2.7e-03
ulcerative colitis 1.300 1.4e-03

Protein-protein Interaction (1)

Gene RIF (48)

AA Sequence

MKRSSVSSGGAGRLSMQELRSQDVNKQGLYTPQTKEKPTFGKLSINKPTSERKVSLFGKRTSGHGSRNSQ      1 - 70
LGIFSSSEKIKDPRPLNDKAFIQQCIRQLCEFLTENGYAHNVSMKSLQAPSVKDFLKIFTFLYGFLCPSY     71 - 140
ELPDTKFEEEVPRIFKDLGYPFALSKSSMYTVGAPHTWPHIVAALVWLIDCIKIHTAMKESSPLFDDGQP    141 - 210
WGEETEDGIMHNKLFLDYTIKCYESFMSGADSFDEMNAELQSKLKDLFNVDAFKLESLEAKNRALNEQIA    211 - 280
RLEQEREKEPNRLESLRKLKASLQGDVQKYQAYMSNLESHSAILDQKLNGLNEEIARVELECETIKQENT    281 - 350
RLQNIIDNQKYSVADIERINHERNELQQTINKLTKDLEAEQQKLWNEELKYARGKEAIETQLAEYHKLAR    351 - 420
KLKLIPKGAENSKGYDFEIKFNPEAGANCLVKYRAQVYVPLKELLNETEEEINKALNKKMGLEDTLEQLN    421 - 490
AMITESKRSVRTLKEEVQKLDDLYQQKIKEAEEEDEKCASELESLEKHKHLLESTVNQGLSEAMNELDAV    491 - 560
QREYQLVVQTTTEERRKVGNNLQRLLEMVATHVGSVEKHLEEQIAKVDREYEECMSEDLSENIKEIRDKY    561 - 630
EKKATLIKSSEE                                                              631 - 642
//

Text Mined References (89)

PMID Year Title