Property Summary

NCBI Gene PubMed Count 34
PubMed Score 86.86
PubTator Score 44.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
active Crohn's disease 1.136 1.4e-02
active ulcerative colitis 1.211 1.7e-02
adult high grade glioma 1.100 2.0e-03
astrocytic glioma -1.800 4.7e-03
Astrocytoma, Pilocytic -1.900 2.4e-08
atypical teratoid / rhabdoid tumor -2.600 3.3e-10
ependymoma -1.400 2.1e-02
glioblastoma -2.100 5.3e-10
group 4 medulloblastoma -1.700 5.4e-05
intraductal papillary-mucinous adenoma (... -1.100 5.2e-03
lung carcinoma 1.500 4.1e-45
malignant mesothelioma -1.500 7.8e-07
medulloblastoma, large-cell 1.500 1.1e-05
non-small cell lung cancer 1.058 2.1e-12
oligodendroglioma -2.800 9.6e-04
osteosarcoma 1.364 3.4e-06
ovarian cancer 2.000 5.9e-12
Pick disease -1.100 3.0e-02
primitive neuroectodermal tumor -1.800 4.3e-04
subependymal giant cell astrocytoma -2.862 6.8e-03

Protein-protein Interaction (6)

Gene RIF (11)

AA Sequence

MCDQTFLVNVFGSCDKCFKQRALRPVFKKSQQLSYCSTCAEIMATEGLHENETLASLKSEAESLKGKLEE      1 - 70
ERAKLHDVELHQVAERVEALGQFVMKTRRTLKGHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDSFTTNKE     71 - 140
HAVTMPCTWVMACAYAPSGCAIACGGLDNKCSVYPLTFDKNENMAAKKKSVAMHTNYLSACSFTNSDMQI    141 - 210
LTASGDGTCALWDVESGQLLQSFHGHGADVLCLDLAPSETGNTFVSGGCDKKAMVWDMRSGQCVQAFETH    211 - 280
ESDINSVRYYPSGDAFASGSDDATCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFAGYNDYTIN    281 - 350
VWDVLKGSRVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRVWA                             351 - 395
//

Text Mined References (34)

PMID Year Title