Property Summary

NCBI Gene PubMed Count 32
Grant Count 93
R01 Count 73
Funding $6,276,490.74
PubMed Score 83.79
PubTator Score 44.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Synonym

Accession O14775 B2RBR5 Q9HAU9 Q9UFT3
Symbols GB5
IDDCA
LADCI

Gene

Gene RIF (10)

PMID Text
25162404 Results suggest that D2R can interact with and stabilize the Gb5 protein, independently of R7 G protein signaling (RGS) proteins.
25043307 The intrinsic resistance to TRAIL-triggered apoptosis of colon cancer cells is overcome by antagonization of Gbeta5.
21511947 Type 5 G protein beta subunit (Gbeta5) controls the interaction of regulator of G protein signaling 9 (RGS9) with membrane anchors
20374718 Gbeta5's function in vision is reviewed.
19773279 Observational study of gene-disease association. (HuGE Navigator)
19376773 cytosolic chaperonin complex-dependent mechanism exists for Gbeta5-RGS7 assembly that utilizes the co-chaperone activity of PhLP1 in a unique way.
18094259 G-protein beta5 short splice variant isoform is indispensable for outer plexiform layer integrity and normal light responses of the retina in transgenic mice.
16867977 cytoplasmic RGS7*Gbeta5*R7BP heterotrimers and RGS7*Gbeta5 heterodimers are equivalently inefficient regulators of G protein-coupled receptor signaling relative to plasma membrane-bound heterotrimers bearing palmitoylated R7BP.
16135253 From yeast two hybrid screening with HBX as bait, human guanine nucleotide binding protein beta subunit 5L (GNbeta5) was isolated from the cDNA library constructed in this study as a new hepatitis b X protein-interacting protein.
15474482 under certain conditions, RGS9 and Gbeta5 may possibly function as betagamma dimer

AA Sequence

MCDQTFLVNVFGSCDKCFKQRALRPVFKKSQQLSYCSTCAEIMATEGLHENETLASLKSEAESLKGKLEE      1 - 70
ERAKLHDVELHQVAERVEALGQFVMKTRRTLKGHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDSFTTNKE     71 - 140
HAVTMPCTWVMACAYAPSGCAIACGGLDNKCSVYPLTFDKNENMAAKKKSVAMHTNYLSACSFTNSDMQI    141 - 210
LTASGDGTCALWDVESGQLLQSFHGHGADVLCLDLAPSETGNTFVSGGCDKKAMVWDMRSGQCVQAFETH    211 - 280
ESDINSVRYYPSGDAFASGSDDATCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFAGYNDYTIN    281 - 350
VWDVLKGSRVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRVWA                             351 - 395
//

Text Mined References (32)

PMID Year Title
25162404 2014 G protein beta 5 is targeted to D2-dopamine receptor-containing biochemical compartments and blocks dopamine-dependent receptor internalization.
25043307 2015 The G?5 protein regulates sensitivity to TRAIL-induced cell death in colon carcinoma.
21511947 2011 Type 5 G protein beta subunit (Gbeta5) controls the interaction of regulator of G protein signaling 9 (RGS9) with membrane anchors.
20374718 2009 The role of G?5 in vision.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19376773 2009 Role of molecular chaperones in G protein beta5/regulator of G protein signaling dimer assembly and G protein betagamma dimer specificity.
18094259 2007 Gbeta5 is required for normal light responses and morphology of retinal ON-bipolar cells.
16867977 2006 R7BP augments the function of RGS7*Gbeta5 complexes by a plasma membrane-targeting mechanism.
16381901 2006 The LIFEdb database in 2006.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
More...