Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.11
PubTator Score 2.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Expression

  Differential Expression (1)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.200 0.018

Synonym

Accession O14771 A8K1B9 B4DMG6 Q96IS1
Symbols CR53
ZSCAN53
ZKSCAN21

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid

AA Sequence

MAAPLEAQDQAPGEGEGLLIVKVEDSSWEQESAQHEDGRDSEACRQRFRQFCYGDVHGPHEAFSQLWELC      1 - 70
CRWLRPELRTKEQILELLVLEQFLTVLPGEIQGWVREQHPGSGEEAVALVEDLQKQPVKAWRQDVPSEEA     71 - 140
EPEAAGRGSQATGPPPTVGARRRPSVPQEQHSHSAQPPALLKEGRPGETTDTCFVSGVHGPVALGDIPFY    141 - 210
FSREEWGTLDPAQRDLFWDIKRENSRNTTLGFGLKGQSEKSLLQEMVPVVPGQTGSDVTVSWSPEEAEAW    211 - 280
ESENRPRAALGPVVGARRGRPPTRRRQFRDLAAEKPHSCGQCGKRFRWGSDLARHQRTHTGEKPHKCPEC    281 - 350
DKSFRSSSDLVRHQGVHTGEKPFSCSECGKSFSRSAYLADHQRIHTGEKPFGCSDCGKSFSLRSYLLDHR    351 - 420
RVHTGERPFGCGECDKSFKQRAHLIAHQSLHAKMAQPVG                                   421 - 459
//

Text Mined References (9)

PMID Year Title
23934736 2013 Genome-wide association study of a heart failure related metabolomic profile among African Americans in the Atherosclerosis Risk in Communities (ARIC) study.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10023065 1999 Identification and characterization of a zinc finger gene (ZNF213) from 16p13.3.
9653642 1998 A transcriptional Map of the FMF region.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.